Id: | acc0010 |
Group: | 1sens |
Protein: | PVT1 H4 |
Gene Symbol: | H4C1 |
Protein Id: | P62805 |
Protein Name: | H4_HUMAN |
PTM: | acetylation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Cancer |
Disease: | Pancreas Cancer |
Disease Subtype: | PDAC |
Disease Cellline: | PANC-1 |
Disease Info: | |
Drug: | gemcitabine |
Drug Info: | "Gemcitabine is a pyrimidine nucleoside analog antimetabolite and antineoplastic agent that inhibits DNA synthesis and repair, leading to autophagy and apoptosis, and is used in the treatment of various solid tumors including non-small cell lung cancer, pancreatic cancer, breast cancer, and ovarian cancer. " |
Effect: | promote |
Effect Info: | Histone acetyltransferase 1 promotes the development of gemcitabine resistance by regulating the PVT1/EZH2 complex in pancreatic cancer. |
Note: | histone |
Score: | 4.0 |
Pubmed(PMID): | 34564701 |
Sentence Index: | 34564701_0 |
Sentence: | Histone acetyltransferase 1 promotes gemcitabine resistance by regulating the PVT1/EZH2 complex in pancreatic cancer. |
Sequence & Structure:
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
K | 16 | A | Colorectal carcinoma | Acetylation | 15765097 |
K | 16 | A | Lymphoma | Acetylation | 15765097 |
K | 16 | A | Squamous cell carcinoma | Acetylation | 15765097 |
K | 12 | D | Friedreich's ataxia | Acetylation | 18045775 |
K | 16 | D | Fragile X syndrome | Methylation | 18628788 |
K | 12 | D | Fragile X syndrome | Methylation | 18628788 |
K | 8 | D | Fragile X syndrome | Methylation | 18628788 |
K | 5 | D | Fragile X syndrome | Methylation | 18628788 |
K | 16 | D | Ovarian cancer | Acetylation | 28866885 |
K | 16 | D | Friedreich's ataxia | Acetylation | 18045775 |
K | 16 | D | Clear cell kidney cancer | Acetylation | 23394073 |
K | 12 | D | Non-small cell lung cancer | Methylation | 18974389 |
K | 16 | D | Non-small cell lung cancer | Methylation | 18974389 |
K | 12 | D | Ovarian cancer | Acetylation | 28866885 |
K | 12 | D | Impaired spermatogenesis | Acetylation | 18001726 |
K | 12 | D | Breast cancer | Acetylation | 21146603 |
K | 20 | D | Non-small cell lung cancer | Methylation | 18974389 |
K | 8 | D | Friedreich's ataxia | Acetylation | 18045775 |
K | 8 | D | Breast cancer | Acetylation | 21146603 |
K | 20 | D | Ovarian cancer | Methylation | 20053926 |
K | 5 | D | Friedreich's ataxia | Acetylation | 18045775 |
K | 16 | D | Alzheimer's disease | Acetylation | 32973937 |
K | 16 | D | Squamous cell carcinoma | Acetylation | 15765097 |
K | 16 | D | Lymphoma | Acetylation | 15765097 |
K | 16 | D | Colorectal carcinoma | Acetylation | 15765097 |
Y | 88 | U | Breast cancer | Phosphorylation | 37330596 |
K | 8 | U | Non-small cell lung cancer | Methylation | 18974389 |
K | 5 | U | Non-small cell lung cancer | Methylation | 18974389 |
K | 20 | U | Prostate cancer | Methylation | 19935671 |
K | 16 | U | Systemic lupus erythematosus | Acetylation | 17530637 ;  25611806 |
K | 12 | U | Systemic lupus erythematosus | Acetylation | 17530637 ;  25611806 |
K | 12 | U | Colorectal cancer | Acetylation | 19057998 |
K | 8 | U | Systemic lupus erythematosus | Acetylation | 17530637 ;  25611806 |
K | 5 | U | Systemic lupus erythematosus | Acetylation | 25611806 |
R | 3 | U | Esophageal carcinoma | Acetylation | 20142251 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.