| Id: | acc0061 |
| Group: | 1sens |
| Protein: | ERK2 |
| Gene Symbol: | Mapk1 |
| Protein Id: | P63086 |
| Protein Name: | MK01_RAT |
| PTM: | phosphorylation |
| Site: | Thr185 |
| Site Sequence: | HDHTGFLTEYVATRWYRAPEI |
| Disease Category: | Endocrine and metabolic diseases |
| Disease: | Insulinoma |
| Disease Subtype: | RINm5F |
| Disease Cellline: | RINm5F |
| Disease Info: | |
| Drug: | hypericin |
| Drug Info: | - |
| Effect: | modulate |
| Effect Info: | Photoactivated hypericin inhibits the proliferation of RINm6F insulinoma cells by down - regulating the phosphorylation of JNK and ERK. |
| Note: | site unclear |
| Score: | 4.0 |
| Pubmed(PMID): | 26182357 |
| Sentence Index: | 26182357_0 |
| Sentence: | Photoactivation of hypericin decreases the viability of RINm5F insulinoma cells through reduction in JNK/ERK phosphorylation and elevation of caspase-9/caspase-3 cleavage and Bax-to-Bcl-2 ratio. |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| Y | 185 | D | Major depressive disorder | Phosphorylation | 16959794 |
| Y | 185 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
