Id: | acc0065 |
Group: | 1sens |
Protein: | CHOP |
Gene Symbol: | DDIT3 |
Protein Id: | P53778 |
Protein Name: | MK12_HUMAN |
PTM: | phosphorylation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Cancer |
Disease: | Glioblastoma |
Disease Subtype: | |
Disease Cellline: | GBM |
Disease Info: | |
Drug: | luteolin |
Drug Info: | "Luteolin is a naturally occurring flavonoid found in various plants, which exhibits anti-inflammatory, antioxidant, and potential anticancer properties, and is currently under investigation for its therapeutic applications in neurodegenerative diseases and cancer." |
Effect: | modulate |
Effect Info: | "Luteolin activates the phosphorylation of eIF2alpha, PERK, CHOP, ATF4 and cleaved caspases to inhibit tumors." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 30798142 |
Sentence Index: | 30798142_6 |
Sentence: | "Furthermore, luteolin increases levels of intracellular reactive oxygen species (ROS) by activation of lethal endoplasmic reticulum stress response and mitochondrial dysfunction in glioblastoma cells, and by activation of ER stress-associated proteins expressions, including phosphorylation of eIF2alpha, PERK, CHOP, ATF4, and cleaved-caspase 12." |
Sequence & Structure:
MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.