Id: | acc0087 |
Group: | 1sens |
Protein: | MARCKS |
Gene Symbol: | MARCKS |
Protein Id: | P29966 |
Protein Name: | MARCS_HUMAN |
PTM: | phosphorylation |
Site: | Ser156 |
Site Sequence: | SNETPKKKKKRFSFKKSFKLS |
Disease Category: | Cancer |
Disease: | Myeloma |
Disease Subtype: | multiple myeloma |
Disease Cellline: | MM.1R |
Disease Info: | |
Drug: | doxorubicin |
Drug Info: | "Doxorubicin is a cytotoxic anthracycline antibiotic and anticancer chemotherapeutic agent that inhibits human DNA topoisomerase I and II with IC50 values of 0.8 μM and 2.67 μM, respectively, and induces apoptosis and autophagy." |
Effect: | inhibit |
Effect Info: | Reduced protein phosphorylation enhances the tumor-killing effect of the drug. |
Note: | |
Score: | 5.0 |
Pubmed(PMID): | 25179733 |
Sentence Index: | 25179733_5 |
Sentence: | "Functionally, inhibition of MARCKS phosphorylation by enzastaurin or knockdown of the gene by RNAi significantly enhanced the sensitivity of resistant HMCLs and primary MM samples to bortezomib and to other anti-myeloma drugs, providing evidence that MARCKS can modulate drug response." |
Sequence & Structure:
MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAPAADKEEPAAAGSGAASPSAAEKGEPAAAAAPEAGASPVEKEAPAEGEAAEPGSPTAAEGEAASAASSTSSPKAEDGATPSPSNETPKKKKKRFSFKKSFKLSGFSFKKNKKEAGEGGEAEAPAAEGGKDEAAGGAAAAAAEAGAASGEQAAAPGEEAAAGEEGAAGGDPQEAKPQEAAVAPEKPPASDETKAAEEPSKVEEKKAEEAGASAAACEAPSAAGPGAPPEQEAAPAEEPAAAAASSACAAPSQEAQPECSPEAPPAEAAE
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
MARCKS | BIO-11006 | Myristoylated alanine-rich C-kinase substrate inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials |
MARCKS | BIO-11006 | Myristoylated alanine-rich C-kinase substrate inhibitor | 2 | Completed | non-small cell lung carcinoma | ClinicalTrials |
MARCKS | BIO-11006 | Myristoylated alanine-rich C-kinase substrate inhibitor | 2 | Completed | adult acute respiratory distress syndrome | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo intensity data of this site,
show all other sites!
MARCKS-Ser101 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.697 | ||||
COAD | 0.361 | ||||
HGSC | -2.884 | ||||
ccRCC | 0.249 | ||||
GBM | 0.233 | ||||
HNSC | 0.697 | ||||
LUAD | 0.265 | ||||
LUSC | 0.427 | ||||
non_ccRCC | -0.332 | ||||
PDAC | 0.321 | ||||
UCEC | -0.033 |
MARCKS-Ser118 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.661 | ||||
HGSC | -2.072 | ||||
ccRCC | 0.636 | ||||
GBM | -0.155 | ||||
HNSC | -0.191 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | 0.857 | ||||
UCEC | 0.265 |
MARCKS-Ser128 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 1.137 | ||||
HGSC | |||||
ccRCC | |||||
GBM | -0.741 | ||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -0.396 |
MARCKS-Ser131 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.707 | ||||
HGSC | -0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
MARCKS-Ser132 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.707 | ||||
HGSC | -0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
MARCKS-Ser134 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 1.042 | ||||
HGSC | -0.951 | ||||
ccRCC | |||||
GBM | -0.091 | ||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
MARCKS-Ser135 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.617 | ||||
HGSC | -2.217 | ||||
ccRCC | |||||
GBM | 0.231 | ||||
HNSC | 0.099 | ||||
LUAD | |||||
LUSC | 0.531 | ||||
non_ccRCC | |||||
PDAC | 0.159 | ||||
UCEC | 0.579 |
MARCKS-Ser145 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.075 | ||||
COAD | 0.902 | ||||
HGSC | -2.757 | ||||
ccRCC | 0.075 | ||||
GBM | -0.441 | ||||
HNSC | 0.546 | ||||
LUAD | 0.63 | ||||
LUSC | 0.639 | ||||
non_ccRCC | -0.239 | ||||
PDAC | 0.116 | ||||
UCEC | 0.454 |
MARCKS-Ser147 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.661 | ||||
COAD | 0.426 | ||||
HGSC | 0.062 | ||||
ccRCC | -0.418 | ||||
GBM | -1.74 | ||||
HNSC | -1.188 | ||||
LUAD | 0.055 | ||||
LUSC | 1.72 | ||||
non_ccRCC | |||||
PDAC | 0.809 | ||||
UCEC | -0.388 |
MARCKS-Ser159 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.933 | ||||
HGSC | -1.677 | ||||
ccRCC | -0.05 | ||||
GBM | 0.37 | ||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | 0.423 | ||||
UCEC |
MARCKS-Ser163 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.518 | ||||
COAD | 0.772 | ||||
HGSC | |||||
ccRCC | 0.296 | ||||
GBM | -1.352 | ||||
HNSC | 0.184 | ||||
LUAD | 0.196 | ||||
LUSC | -0.841 | ||||
non_ccRCC | 0.888 | ||||
PDAC | 1.159 | ||||
UCEC | -1.819 |
MARCKS-Ser167 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.563 | ||||
COAD | 0.51 | ||||
HGSC | -1.143 | ||||
ccRCC | -0.432 | ||||
GBM | -1.091 | ||||
HNSC | -0.739 | ||||
LUAD | 1.396 | ||||
LUSC | -0.249 | ||||
non_ccRCC | 1.961 | ||||
PDAC | -0.195 | ||||
UCEC | 0.546 |
MARCKS-Ser170 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.565 | ||||
COAD | 0.861 | ||||
HGSC | -2.46 | ||||
ccRCC | -0.346 | ||||
GBM | -0.69 | ||||
HNSC | 0.37 | ||||
LUAD | 0.298 | ||||
LUSC | 0.978 | ||||
non_ccRCC | 0.964 | ||||
PDAC | 0.224 | ||||
UCEC | 0.365 |
MARCKS-Ser26 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.068 | ||||
COAD | 0.809 | ||||
HGSC | -2.455 | ||||
ccRCC | -0.678 | ||||
GBM | -0.123 | ||||
HNSC | 0.287 | ||||
LUAD | 0.465 | ||||
LUSC | 1.25 | ||||
non_ccRCC | -0.172 | ||||
PDAC | 0.94 | ||||
UCEC | -0.256 |
MARCKS-Ser262 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.785 | ||||
COAD | |||||
HGSC | 1.818 | ||||
ccRCC | |||||
GBM | -0.988 | ||||
HNSC | |||||
LUAD | 0.522 | ||||
LUSC | 0.275 | ||||
non_ccRCC | -0.868 | ||||
PDAC | 0.026 | ||||
UCEC |
MARCKS-Ser27 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.205 | ||||
HGSC | 0.882 | ||||
ccRCC | |||||
GBM | -1.086 | ||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
MARCKS-Ser29 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | -0.707 | ||||
HGSC | 0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
MARCKS-Ser46 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.478 | ||||
COAD | 0.635 | ||||
HGSC | 2.031 | ||||
ccRCC | -0.494 | ||||
GBM | 0.073 | ||||
HNSC | 0.019 | ||||
LUAD | 0.527 | ||||
LUSC | 0.044 | ||||
non_ccRCC | -1.63 | ||||
PDAC | -0.038 | ||||
UCEC | 0.312 |
MARCKS-Ser52 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.873 | ||||
COAD | -0.334 | ||||
HGSC | 2.362 | ||||
ccRCC | 0.132 | ||||
GBM | -0.096 | ||||
HNSC | |||||
LUAD | -0.358 | ||||
LUSC | -0.407 | ||||
non_ccRCC | -1.102 | ||||
PDAC | -0.287 | ||||
UCEC | 0.964 |
MARCKS-Ser63 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.352 | ||||
COAD | 0.173 | ||||
HGSC | 1.777 | ||||
ccRCC | 0.09 | ||||
GBM | -0.666 | ||||
HNSC | 0.122 | ||||
LUAD | 0.655 | ||||
LUSC | 0.09 | ||||
non_ccRCC | -1.848 | ||||
PDAC | 0.8 | ||||
UCEC | 0.16 |
MARCKS-Ser77 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.764 | ||||
COAD | 0.698 | ||||
HGSC | 1.129 | ||||
ccRCC | -0.508 | ||||
GBM | -2.313 | ||||
HNSC | 0.099 | ||||
LUAD | -0.032 | ||||
LUSC | 0.416 | ||||
non_ccRCC | |||||
PDAC | 0.518 | ||||
UCEC | -0.77 |
MARCKS-Ser81 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.719 | ||||
COAD | -0.03 | ||||
HGSC | 2.218 | ||||
ccRCC | 0.108 | ||||
GBM | -0.469 | ||||
HNSC | 0.439 | ||||
LUAD | 0.59 | ||||
LUSC | 0.49 | ||||
non_ccRCC | -0.917 | ||||
PDAC | -0.258 | ||||
UCEC | -0.452 |
MARCKS-Ser83 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | -0.707 | ||||
ccRCC | |||||
GBM | 0.707 | ||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
MARCKS-Thr120 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.459 | ||||
HGSC | -1.962 | ||||
ccRCC | 0.516 | ||||
GBM | 0.451 | ||||
HNSC | -0.136 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.672 |
MARCKS-Thr143 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.854 | ||||
COAD | 1.491 | ||||
HGSC | |||||
ccRCC | 0.435 | ||||
GBM | -1.343 | ||||
HNSC | 1.436 | ||||
LUAD | 0.608 | ||||
LUSC | 0.173 | ||||
non_ccRCC | -1.036 | ||||
PDAC | -0.688 | ||||
UCEC | -0.222 |
MARCKS-Thr150 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.189 | ||||
COAD | 0.882 | ||||
HGSC | -1.884 | ||||
ccRCC | 0.487 | ||||
GBM | -1.641 | ||||
HNSC | -0.51 | ||||
LUAD | 0.498 | ||||
LUSC | 0.07 | ||||
non_ccRCC | 1.292 | ||||
PDAC | 0.615 | ||||
UCEC | 0.381 |
MARCKSL1-Ser101 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.816 | ||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | -1.233 | ||||
HNSC | -0.026 | ||||
LUAD | -1.069 | ||||
LUSC | 0.243 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 1.269 |
MARCKSL1-Ser104 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.458 | ||||
COAD | -0.164 | ||||
HGSC | 2.54 | ||||
ccRCC | 0.017 | ||||
GBM | 0.015 | ||||
HNSC | -0.579 | ||||
LUAD | -0.34 | ||||
LUSC | -0.495 | ||||
non_ccRCC | 0.307 | ||||
PDAC | -0.466 | ||||
UCEC | 0.623 |
MARCKSL1-Ser119 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.1 | ||||
HGSC | -1.473 | ||||
ccRCC | -0.13 | ||||
GBM | |||||
HNSC | |||||
LUAD | 0.171 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 1.332 |
MARCKSL1-Ser120 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.235 | ||||
HGSC | -1.602 | ||||
ccRCC | 0.019 | ||||
GBM | |||||
HNSC | |||||
LUAD | 0.189 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 1.159 |
MARCKSL1-Ser135 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.103 | ||||
COAD | 0.332 | ||||
HGSC | -2.794 | ||||
ccRCC | 0.31 | ||||
GBM | 0.239 | ||||
HNSC | 0.412 | ||||
LUAD | 0.166 | ||||
LUSC | 0.333 | ||||
non_ccRCC | |||||
PDAC | 0.575 | ||||
UCEC | 0.529 |
MARCKSL1-Ser151 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.14 | ||||
COAD | 0.534 | ||||
HGSC | -2.753 | ||||
ccRCC | 0.436 | ||||
GBM | 0.427 | ||||
HNSC | 0.408 | ||||
LUAD | 0.265 | ||||
LUSC | -0.133 | ||||
non_ccRCC | |||||
PDAC | 0.608 | ||||
UCEC | 0.349 |
MARCKSL1-Ser162 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | -0.707 | ||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.707 |
MARCKSL1-Ser165 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.262 | ||||
HGSC | -1.467 | ||||
ccRCC | |||||
GBM | 0.438 | ||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.766 |
MARCKSL1-Ser177 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | -0.707 | ||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.707 |
MARCKSL1-Ser180 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | 0.707 | ||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -0.707 |
MARCKSL1-Ser22 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.879 | ||||
COAD | 0.219 | ||||
HGSC | -1.031 | ||||
ccRCC | 0.559 | ||||
GBM | -0.474 | ||||
HNSC | -0.399 | ||||
LUAD | -2.051 | ||||
LUSC | |||||
non_ccRCC | 1.301 | ||||
PDAC | 0.61 | ||||
UCEC | 0.386 |
MARCKSL1-Ser36 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -2.14 | ||||
COAD | 0.481 | ||||
HGSC | 1.879 | ||||
ccRCC | -0.124 | ||||
GBM | 0.097 | ||||
HNSC | 0.048 | ||||
LUAD | -0.581 | ||||
LUSC | -0.844 | ||||
non_ccRCC | 0.667 | ||||
PDAC | 0.275 | ||||
UCEC | 0.242 |
MARCKSL1-Ser41 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | -0.707 | ||||
HGSC | 0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
MARCKSL1-Ser48 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.407 | ||||
HGSC | 0.733 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | -1.139 | ||||
UCEC |
MARCKSL1-Ser71 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -2.1 | ||||
COAD | 0.503 | ||||
HGSC | |||||
ccRCC | 0.244 | ||||
GBM | -0.017 | ||||
HNSC | 0.311 | ||||
LUAD | -1.072 | ||||
LUSC | 0.363 | ||||
non_ccRCC | |||||
PDAC | 1.295 | ||||
UCEC | 0.473 |
MARCKSL1-Ser93 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.707 | ||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | 0.707 | ||||
PDAC | |||||
UCEC |
MARCKSL1-Thr122 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | -0.303 | ||||
HGSC | -1.152 | ||||
ccRCC | -0.04 | ||||
GBM | |||||
HNSC | 0.198 | ||||
LUAD | -0.512 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 1.81 |
MARCKSL1-Thr14 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.274 | ||||
COAD | 0.6 | ||||
HGSC | -1.644 | ||||
ccRCC | 0.352 | ||||
GBM | -0.983 | ||||
HNSC | -1.006 | ||||
LUAD | 0.176 | ||||
LUSC | 1.062 | ||||
non_ccRCC | -1.054 | ||||
PDAC | 1.02 | ||||
UCEC | 1.204 |
MARCKSL1-Thr148 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.575 | ||||
COAD | 0.767 | ||||
HGSC | -2.168 | ||||
ccRCC | 0.764 | ||||
GBM | 0.544 | ||||
HNSC | 0.235 | ||||
LUAD | 0.241 | ||||
LUSC | -0.02 | ||||
non_ccRCC | -1.353 | ||||
PDAC | 1.19 | ||||
UCEC | 0.375 |
MARCKSL1-Thr174 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.647 | ||||
HGSC | -0.997 | ||||
ccRCC | |||||
GBM | -0.698 | ||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 1.049 |
MARCKSL1-Thr178 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | 0.707 | ||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -0.707 |
MARCKSL1-Thr85 | |
---|---|
Cancer | Intensity |
BRCA | -1.455 |
COAD | -0.068 |
HGSC | 2.479 |
ccRCC | -0.025 |
GBM | -0.963 |
HNSC | -0.549 |
LUAD | 0.047 |
LUSC | 0.202 |
non_ccRCC | -0.421 |
PDAC | 0.375 |
UCEC | 0.377 |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
K | 165 | A | Neural tube defect | Acetylation | 30655546 |
K | 165 | P | Neural tube defect | Acetylation | 30655546 |
- | - | P | Glioma | Phosphorylation | 8455032 |
- | - | P | B-cell chronic lymphocytic leukemia | Phosphorylation | 8596017 |
S | 46 | U | Alzheimer's disease | Phosphorylation | 27557632 |
S | 132 | U | Alzheimer's disease | Phosphorylation | 27557632 |
S | 147 | U | Alzheimer's disease | Phosphorylation | 27557632 |
T | 150 | U | Alzheimer's disease | Phosphorylation | 27557632 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.