| Id: | acc0121 |
| Group: | 1sens |
| Protein: | PP2A |
| Gene Symbol: | PTPA |
| Protein Id: | Q15257 |
| Protein Name: | PTPA_HUMAN |
| PTM: | phosphorylation |
| Site: | Tyr307 |
| Site Sequence: | MKTGPFAEHSNQLWNISAVPS |
| Disease Category: | Cancer |
| Disease: | Colorectal Cancer |
| Disease Subtype: | |
| Disease Cellline: | SW480 |
| Disease Info: | |
| Drug: | aspirin |
| Drug Info: | "Aspirin (acetylsalicylic acid) is a non-steroidal anti-inflammatory drug (NSAID) used to relieve pain, reduce fever, and decrease inflammation, while also acting as an antiplatelet agent to prevent blood clot formation in cardiovascular diseases." |
| Effect: | modulate |
| Effect Info: | "Aspirin inhibits the activity of the Wnt/beta-catenin pathway in colon cancer cell lines in a dose-dependent manner through a mechanism mediated by protein phosphatase 2A, reduces the luciferase activity driven by TCF and the expression of Wnt target genes, and enhances the phosphorylation of beta-catenin. " |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 16878161 |
| Sentence Index: | 16878161_3 |
| Sentence: | "We studied the effects of aspirin on the oncogenic Wnt/beta-catenin pathway activity in colorectal cancer cell lines and observed that aspirin dose-dependently decreased the activity of this pathway, as judged by TCF-driven luciferase activity, reduced Wnt target gene expression and increased phosphorylation of beta-catenin by immunoblotting." |
Sequence & Structure:
MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEMWNEVHEEKEQAAKQSVSCDECIPLPRAGHCAPSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
