Id: | acc0327 |
Group: | 1sens_supp |
Protein: | PKCalpha |
Gene Symbol: | PRKCA |
Protein Id: | P17252 |
Protein Name: | KPCA_HUMAN |
PTM: | phosphorylation |
Site: | Ser657 |
Site Sequence: | IDQSDFEGFSYVNPQFVHPIL |
Disease Category: | Cancer |
Disease: | Hemangioma |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | rapamycin |
Drug Info: | "Rapamycin is a macrolide immunosuppressant and antiproliferative drug used primarily to prevent organ transplant rejection and in cancer therapy, requiring regular monitoring of blood drug concentrations due to its narrow therapeutic index." |
Effect: | modulate |
Effect Info: | "Rapamycin inhibits the phosphorylation of S6K in tumor cells and eliminates the feedback inhibition of S6K, leading to an increase in the phosphorylation of Akt (serine 473) and PKCalpha. Rapamycin significantly reduces the growth of vascular tumors both in vitro and in vivo. Rapamycin reduces two known targets of mTORC2, p-Akt (S473) and p-PKCalpha (S657), in a dose-dependent manner, and a significant reduction is observed at 25 ng/ml." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 23938603 |
Sentence Index: | 23938603_8 |
Sentence: | "Rapamycin fully inhibited mTORC1 and partially inhibited mTORC2 activities, including the phosphorylation of Akt (serine 473) and PKCalpha, in vascular tumor cells." |
Sequence & Structure:
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
PRKCA | MIDOSTAURIN | Protein kinase C (PKC) inhibitor | 4 | - | acute myeloid leukemia | FDA |
PRKCA | MIDOSTAURIN | Protein kinase C (PKC) inhibitor | 4 | - | neoplasm | ATC |
PRKCA | MIDOSTAURIN | Protein kinase C (PKC) inhibitor | 4 | - | mast-cell leukemia | DailyMed FDA |
PRKCA | MIDOSTAURIN | Protein kinase C (PKC) inhibitor | 4 | - | Mastocytosis | DailyMed |
PRKCA | MIDOSTAURIN | Protein kinase C (PKC) inhibitor | 4 | - | systemic mastocytosis | FDA |
PRKCA | MIDOSTAURIN | Protein kinase C (PKC) inhibitor | 3 | Completed | acute myeloid leukemia | ClinicalTrials ClinicalTrials |
PRKCA | MIDOSTAURIN | Protein kinase C (PKC) inhibitor | 3 | Recruiting | acute myeloid leukemia | ClinicalTrials ClinicalTrials |
PRKCA | MIDOSTAURIN | Protein kinase C (PKC) inhibitor | 3 | Unknown status | leukemia | ClinicalTrials |
PRKCA | APRINOCARSEN | Protein kinase C alpha mRNA 3'UTR antisense inhibitor | 3 | Completed | non-small cell lung carcinoma | ClinicalTrials |
PRKCA | MIDOSTAURIN | Protein kinase C (PKC) inhibitor | 2 | Active, not recruiting | acute myeloid leukemia | ClinicalTrials ClinicalTrials |
PRKCA | MIDOSTAURIN | Protein kinase C (PKC) inhibitor | 2 | Completed | acute myeloid leukemia | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
PRKCA | MIDOSTAURIN | Protein kinase C (PKC) inhibitor | 2 | Active, not recruiting | myelodysplastic syndrome | ClinicalTrials |
PRKCA | MIDOSTAURIN | Protein kinase C (PKC) inhibitor | 2 | Recruiting | myelodysplastic syndrome | ClinicalTrials |
PRKCA | MIDOSTAURIN | Protein kinase C (PKC) inhibitor | 2 | Recruiting | acute myeloid leukemia | ClinicalTrials ClinicalTrials |
PRKCA | MIDOSTAURIN | Protein kinase C (PKC) inhibitor | 2 | Terminated | acute myeloid leukemia | ClinicalTrials |
PRKCA | MIDOSTAURIN | Protein kinase C (PKC) inhibitor | 2 | Withdrawn | acute myeloid leukemia | ClinicalTrials ClinicalTrials |
PRKCA | MIDOSTAURIN | Protein kinase C (PKC) inhibitor | 2 | Completed | leukemia | ClinicalTrials |
PRKCA | UCN-01 | Protein kinase C (PKC) inhibitor | 2 | Terminated | lymphoma | ClinicalTrials |
PRKCA | SOTRASTAURIN | Protein kinase C (PKC) inhibitor | 2 | Completed | psoriasis | ClinicalTrials |
PRKCA | UCN-01 | Protein kinase C (PKC) inhibitor | 2 | Completed | small cell lung carcinoma | ClinicalTrials |
PRKCA | SOTRASTAURIN | Protein kinase C (PKC) inhibitor | 2 | Completed | ulcerative colitis | ClinicalTrials |
PRKCA | UCN-01 | Protein kinase C (PKC) inhibitor | 2 | Terminated | melanoma | ClinicalTrials |
PRKCA | UCN-01 | Protein kinase C (PKC) inhibitor | 2 | Completed | pancreatic carcinoma | ClinicalTrials |
PRKCA | APRINOCARSEN | Protein kinase C alpha mRNA 3'UTR antisense inhibitor | 2 | Completed | non-small cell lung carcinoma | ClinicalTrials |
PRKCA | MIDOSTAURIN | Protein kinase C (PKC) inhibitor | 2 | Completed | mast-cell leukemia | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACPRKCA-Ser657 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | -0.707 |
GBM | 0.707 |
HNSC | |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | P | Acute myelomonocytic leukemia | Phosphorylation | 24334295 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.