Id: | acc0394 |
Group: | 1sens |
Protein: | HSP27 |
Gene Symbol: | HSPB1 |
Protein Id: | P04792 |
Protein Name: | HSPB1_HUMAN |
PTM: | phosphorylation |
Site: | Ser78 |
Site Sequence: | AAPAYSRALSRQLSSGVSEIR |
Disease Category: | Cancer |
Disease: | Colorectal Cancer |
Disease Subtype: | |
Disease Cellline: | HT29 |
Disease Info: | |
Drug: | 5-fluorouracil |
Drug Info: | "5-Fluorouracil (5-FU) is a pyrimidine analog antimetabolite and antineoplastic agent that inhibits thymidylate synthase, thereby interfering with DNA synthesis, and is primarily used in the treatment of colorectal, breast, gastric, pancreatic, and head and neck cancers. " |
Effect: | inhibit |
Effect Info: | Inhibit the phosphorylation of HSP27 and enhance the sensitivity of colorectal cancer cells to 5 - FU |
Note: | |
Score: | 5.0 |
Pubmed(PMID): | 25364415 |
Sentence Index: | 25364415_1 |
Sentence: | "The aim of the present study was to investigate whether the inhibition of HSP27 phosphorylation, which affects certain cellular functions, modulates sensitivity to 5-fluorouracil (5-FU) in colorectal cancer cells." |
Sequence & Structure:
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 2 | Unknown status | squamous cell lung carcinoma | ClinicalTrials |
HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 2 | Completed | pancreatic carcinoma | ClinicalTrials |
HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 2 | Completed | non-small cell lung carcinoma | ClinicalTrials |
HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 2 | Completed | prostate cancer | ClinicalTrials |
HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 2 | Terminated | prostate cancer | ClinicalTrials |
HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 1 | Completed | neoplasm | ClinicalTrials |
HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 1 | Unknown status | urinary bladder cancer | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACHSPB1-Ser78 | |
---|---|
Cancer | Intensity |
BRCA | 0.707 |
COAD | |
HGSC | |
ccRCC | -0.707 |
GBM | |
HNSC | |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 78 | N | Dilated cardiomyopathy | Phosphorylation | 34477462 |
S | 78 | P | Pancreatic cancer/carcinoma/adenocarcinoma | Phosphorylation | 22012255 |
S | 78 | U | Breast cancer/tumor/carcinoma | Phosphorylation | 17697330 |
S | 78 | U | Head and neck squamous cell carcinoma | Phosphorylation | 34498800 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.