| Id: | acc0497 |
| Group: | 1sens |
| Protein: | PPARgamma |
| Gene Symbol: | Pparg |
| Protein Id: | P37238 |
| Protein Name: | PPARG_MOUSE |
| PTM: | phosphorylation |
| Site: | Ser82 |
| Site Sequence: | ISAPHYEDIPFTRADPMVADY |
| Disease Category: | Cancer |
| Disease: | Hepatocellular Carcinoma |
| Disease Subtype: | |
| Disease Cellline: | Hepa1-6 |
| Disease Info: | |
| Drug: | PD0325901 |
| Drug Info: | "PD0325901 is a selective MEK1/MEK2 inhibitor that suppresses tumor cell proliferation by targeting the ERK signaling pathway, primarily used in preclinical research for its potential anticancer properties. " |
| Effect: | modulate |
| Effect Info: | The MEK inhibitor PD0325901 can inhibit tumor growth by suppressing the phosphorylation of PPARgamma. |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 27769068 |
| Sentence Index: | 27769068_0 |
| Sentence: | Phosphorylation of PPARgamma at Ser84 promotes glycolysis and cell proliferation in hepatocellular carcinoma by targeting PFKFB4. |
Sequence & Structure:
MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| - | - | D | Hypercholesterolemia | Acetylation | 36453279 |
| - | - | D | Atherosclerosis | Acetylation | 36453279 |
| S | 112 | D | Obesity | Phosphorylation | 18204460 |
| S | 273 | U | Hepatitis | Phosphorylation | 30008738 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
