Id: | acc0534 |
Group: | 1sens |
Protein: | ERK2 |
Gene Symbol: | Mapk1 |
Protein Id: | P63086 |
Protein Name: | MK01_RAT |
PTM: | phosphorylation |
Site: | Tyr187 |
Site Sequence: | HTGFLTEYVATRWYRAPEIML |
Disease Category: | Endocrine and metabolic diseases |
Disease: | Pituitary Tumor |
Disease Subtype: | |
Disease Cellline: | GH3 |
Disease Info: | |
Drug: | trastuzumab + TGFB1 |
Drug Info: | "Trastuzumab is a recombinant humanized monoclonal antibody targeting HER2 (human epidermal growth factor receptor 2), used for the treatment of HER2-positive breast cancer and gastric cancer. TGFB1: - " |
Effect: | modulate |
Effect Info: | "Trastuzumab co - incubated with TGFB1 induced a significant increase in the expression of p - Smad2/3 and a significant decrease in the phosphorylation of ERK1/2, thereby inhibiting tumor proliferation." |
Note: | drug comb |
Score: | 4.0 |
Pubmed(PMID): | 29875136 |
Sentence Index: | 29875136_6 |
Sentence: | "In tumoral GH3 cells, co-incubation with trastuzumab and TGFB1 significantly decreased cell proliferation, an effect accompanied by a reduction in ERK1/2 phosphorylation, an increase of SMAD2/3 activation." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | A | Basophilic leukemia | Phosphorylation | 11971018 |
T | 183 | D | Major depressive disorder | Phosphorylation | 16959794 |
Y | 185 | D | Major depressive disorder | Phosphorylation | 16959794 |
T | 183 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
Y | 185 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.