Id: | acc0586 |
Group: | 1sens |
Protein: | PHB |
Gene Symbol: | PHB1 |
Protein Id: | P35232 |
Protein Name: | PHB1_HUMAN |
PTM: | phosphorylation |
Site: | Tyr259 |
Site Sequence: | QLSRSRNITYLPAGQSVLLQL |
Disease Category: | Cancer |
Disease: | Ovarian Cancer |
Disease Subtype: | |
Disease Cellline: | KURAMOCHI |
Disease Info: | |
Drug: | platinum |
Drug Info: | "Cisplatin: A platinum-containing chemotherapeutic agent used in the treatment of various cancers, including testicular, ovarian, and lung cancers, by forming DNA adducts that inhibit cancer cell replication. Carboplatin: A second-generation platinum-based antineoplastic drug with reduced nephrotoxicity compared to cisplatin, commonly employed in ovarian cancer and other malignancies. Oxaliplatin: A third-generation platinum compound effective against colorectal cancer, characterized by its distinct mechanism of action and reduced cross-resistance with other platinum drugs. " |
Effect: | inhibit |
Effect Info: | "c-Kit interacts with PHB, promoting the phosphorylation of PHBY259 in membrane rafts, thereby enhancing the motility of ovarian cancer cells and conferring resistance to platinum drugs." |
Note: | |
Score: | 5.0 |
Pubmed(PMID): | 32169072 |
Sentence Index: | 32169072_8 |
Sentence: | c-Kit interacted with PHB and facilitated the phosphorylation of PHB at tyrosine 259 (phospho-PHBY259) in the membrane raft to enhance ovarian cancer cell motility. |
Sequence & Structure:
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACEPHB1-Ser899 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | 0.707 |
GBM | -0.707 |
HNSC | |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
Y | 259 | P | Ovarian cancer | Phosphorylation | 32169072 |
Y | 259 | U | Cervical adenocarcinoma | Phosphorylation | 22410782 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.