Id: acc0675
Group: 1sens
Protein: YAP
Gene Symbol: YAP1
Protein Id: P46937
Protein Name: YAP1_HUMAN
PTM: phosphorylation
Site: Ser127
Site Sequence: LTPQHVRAHSSPASLQLGAVS
Disease Category: Cancer
Disease: Ovarian Cancer
Disease Subtype:
Disease Cellline: ES-2
Disease Info:
Drug: Cisplatin
Drug Info: "Cisplatin is a platinum-based chemotherapeutic agent widely used in the treatment of various malignancies, including ovarian, bladder, testicular, and non-small cell lung cancers, by forming DNA cross-links to interfere with replication and repair, thereby inhibiting cancer cell growth and proliferation."
Effect: inhibit
Effect Info: "S1PR1 is highly expressed in ovarian cancer tissues and cell lines. Its deficiency inhibits the proliferation and migration of ovarian cancer cells, promotes cell senescence, inhibits YAP phosphorylation, and enhances the sensitivity to cisplatin chemotherapy."
Note:
Score: 5.0
Pubmed(PMID): 37828220
Sentence Index:
Sentence:

Sequence & Structure:

MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets
Small molecule
Antibody
PROTAC
Other modalities
Approved Drug
Advanced Clinical
Phase 1 Clinical
Structure with Ligand
High-Quality Ligand
High-Quality Pocket
Med-Quality Pocket
Druggable Family
Approved Drug
Advanced Clinical
Phase 1 Clinical
UniProt loc high conf
GO CC high conf
UniProt loc med conf
UniProt SigP or TMHMM
GO CC med conf
Human Protein Atlas loc
Approved Drug
Advanced Clinical
Phase 1 Clinical
Literature
UniProt Ubiquitination
Database Ubiquitination
Half-life Data
Small Molecule Binder
Approved Drug
Advanced Clinical
Phase 1 Clinical

PTM Intensity:

source: CPTAC
YAP1-Ser127
Cancer Intensity
BRCA
COAD 0.729
HGSC -1.387
ccRCC
GBM
HNSC 0.735
LUAD -0.077
LUSC
non_ccRCC
PDAC
UCEC

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
S 127 A Hepatocellular carcinoma/hepatocarcinoma/hepatoma Phosphorylation 22761457
S 127 A Adult T-cell leukemia/lymphoma Phosphorylation 35210364
S 127 D Bladder cancer Phosphorylation 26119935
S 127 D Glioblastoma Phosphorylation 34343153
S 127 D Prostate cancer Phosphorylation 36823643
S 127 D Lung cancer/carcinoma Phosphorylation 21060948
S 127 D Renal cell carcinoma Phosphorylation 32926756
S 127 D Liver cancer Phosphorylation 28474680
S 127 D Diabetes mellitus Phosphorylation 28474680
S 127 D Coronary artery disease Phosphorylation 37104914
S 127 P Cervical cancer/carcinoma Phosphorylation 23027127
S 127 P Hepatocellular cancer Phosphorylation 35597479
S 127 P Colon cancer Phosphorylation 34206989
S 127 U Hepatocellular cancer Phosphorylation 35586495
S 127 U Parkinson's disease Phosphorylation 32929029
S 127 U Osteoarthritis Phosphorylation 37100374
S 127 U Breast cancer Phosphorylation 36774339

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: