Id: acc0732
Group: 2sens
Protein: FOXO1
Gene Symbol: FOXO1
Protein Id: Q12778
Protein Name: FOXO1_HUMAN
PTM: acetylation
Site: Thr24
Site Sequence: EPLPRPRSCTWPLPRPEFSQS
Disease Category: Cancer
Disease: Lung Cancer
Disease Subtype: NSCLC
Disease Cellline: PC9
Disease Info:
Drug: Ku0063794 + Erlotinib
Drug Info: "Ku-0063794 is a cell-permeable, selective dual inhibitor of mTORC1 and mTORC2 with an IC50 of 10 nM, which induces G1-cell cycle arrest and autophagy, and inhibits tumor growth in renal cell carcinoma xenograft models. Erlotinib is a direct-acting EGFR tyrosine kinase inhibitor with an IC50 of 2 nM for human EGFR, used in the treatment of non-small cell lung cancer (NSCLC) by reducing EGFR autophosphorylation in intact tumor cells. "
Effect: modulate
Effect Info: These drugs affect the growth and apoptosis of tumor cells by regulating the phosphorylation and acetylation status of FOXO1.
Note: drug comb
Score: 4.0
Pubmed(PMID): 26036758
Sentence Index:
Sentence:

Sequence & Structure:

MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets
Small molecule
Antibody
PROTAC
Other modalities
Approved Drug
Advanced Clinical
Phase 1 Clinical
Structure with Ligand
High-Quality Ligand
High-Quality Pocket
Med-Quality Pocket
Druggable Family
Approved Drug
Advanced Clinical
Phase 1 Clinical
UniProt loc high conf
GO CC high conf
UniProt loc med conf
UniProt SigP or TMHMM
GO CC med conf
Human Protein Atlas loc
Approved Drug
Advanced Clinical
Phase 1 Clinical
Literature
UniProt Ubiquitination
Database Ubiquitination
Half-life Data
Small Molecule Binder
Approved Drug
Advanced Clinical
Phase 1 Clinical

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
T 24 D Head and neck squamous cell carcinoma Phosphorylation 21281788
T 24 U Breast cancer Phosphorylation 36797347
T 24 U Prostate cancer Phosphorylation 36720852

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: