Id: acc0736
Group: 2sens
Protein: GD3
Gene Symbol: ST8SIA1
Protein Id: Q92185
Protein Name: SIA8A_HUMAN
PTM: acetylation
Site: unclear
Site Sequence:
Disease Category: Cancer
Disease: Medulloblastoma
Disease Subtype:
Disease Cellline: RES256
Disease Info:
Drug: etoposide
Drug Info: "Etoposide is a chemotherapeutic agent that inhibits topoisomerase II, leading to DNA strand breaks and apoptosis, and is used in the treatment of various cancers including small cell lung cancer, testicular cancer, and lymphomas, administered intravenously or orally."
Effect: inhibit
Effect Info: "SIAE reduces the acetylation of GD3, leading to an increased expression of GD3, which in turn increases the sensitivity of medulloblastoma cell lines to etoposide."
Note:
Score: 5.0
Pubmed(PMID): 31197190
Sentence Index:
Sentence:

Sequence & Structure:

MSPCGRARRQTSRGAMAVLAWKFPRTRLPMGASALCVVVLCWLYIFPVYRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTS

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets
Small molecule
Antibody
PROTAC
Other modalities
Approved Drug
Advanced Clinical
Phase 1 Clinical
Structure with Ligand
High-Quality Ligand
High-Quality Pocket
Med-Quality Pocket
Druggable Family
Approved Drug
Advanced Clinical
Phase 1 Clinical
UniProt loc high conf
GO CC high conf
UniProt loc med conf
UniProt SigP or TMHMM
GO CC med conf
Human Protein Atlas loc
Approved Drug
Advanced Clinical
Phase 1 Clinical
Literature
UniProt Ubiquitination
Database Ubiquitination
Half-life Data
Small Molecule Binder
Approved Drug
Advanced Clinical
Phase 1 Clinical

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: