| Id: | acc0740 |
| Group: | 2sens |
| Protein: | 6PGD |
| Gene Symbol: | PGD |
| Protein Id: | P52209 |
| Protein Name: | 6PGD_HUMAN |
| PTM: | methylation |
| Site: | Arg324 |
| Site Sequence: | DKKSFLEDIRKALYASKIISY |
| Disease Category: | Cancer |
| Disease: | Lung Cancer |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Cisplatin |
| Drug Info: | "Cisplatin is a platinum-based chemotherapeutic agent widely used in the treatment of various malignancies, including ovarian, bladder, testicular, and non-small cell lung cancers, by forming DNA cross-links to interfere with replication and repair, thereby inhibiting cancer cell growth and proliferation." |
| Effect: | inhibit |
| Effect Info: | "PRMT6 methylates R324 of 6PGD to enhance its activity; while the methylation at the R9 and R372 sites of ENO1 promotes the formation of the active ENO1 dimer and the binding of ENO1 with 2-phosphoglycerate (2-PG), respectively, thereby promoting the growth of lung cancer. Targeting PRMT6 can block tumor growth and enhance the anti-tumor effect of cisplatin." |
| Note: | |
| Score: | 5.0 |
| Pubmed(PMID): | 36815049 |
| Sentence Index: | 36815049_5-6 |
| Sentence: | "Furthermore, PRMT6 methylated R324 of 6PGD to enhancing its activity; while methylation at R9 and R372 of ENO1 promotes formation of active ENO1 dimers and 2-phosphoglycerate (2-PG) binding to ENO1, respectively. Lastly, targeting PRMT6 blocked the oxidative PPP flux, glycolysis pathway, and tumor growth, as well as enhanced the anti-tumor effects of cisplatin in lung cancer." |
Sequence & Structure:
MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| R | 324 | U | Lung cancer | Methylation | 36815049 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
