Id: acc0781
Group: 2sens
Protein: Smad3
Gene Symbol: SMAD3
Protein Id: P84022
Protein Name: SMAD3_HUMAN
PTM: phosphorylation
Site: Ser423
Site Sequence: MGSPSIRCSSVS---------
Disease Category: Cancer
Disease: Prostate Cancer
Disease Subtype:
Disease Cellline: LNCaP C4-2B
Disease Info:
Drug: apigenin
Drug Info: "Apigenin is a naturally occurring flavonoid compound with demonstrated potential as an antifungal agent in the preparation of drugs against human fungal infections, and it is also being researched in drug delivery systems such as solid lipid nanoparticles (APG-SLNP) to enhance stability and bioavailability. "
Effect: modulate
Effect Info: "Apigenin inhibits prostate carcinogenesis by suppressing the phosphorylation of Smad2/3, Src, FAK, and Akt."
Note:
Score: 4.0
Pubmed(PMID): 23359392
Sentence Index:
Sentence:

Sequence & Structure:

MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets
Small molecule
Antibody
PROTAC
Other modalities
Approved Drug
Advanced Clinical
Phase 1 Clinical
Structure with Ligand
High-Quality Ligand
High-Quality Pocket
Med-Quality Pocket
Druggable Family
Approved Drug
Advanced Clinical
Phase 1 Clinical
UniProt loc high conf
GO CC high conf
UniProt loc med conf
UniProt SigP or TMHMM
GO CC med conf
Human Protein Atlas loc
Approved Drug
Advanced Clinical
Phase 1 Clinical
Literature
UniProt Ubiquitination
Database Ubiquitination
Half-life Data
Small Molecule Binder
Approved Drug
Advanced Clinical
Phase 1 Clinical

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
K 333 D Nonalcoholic steatohepatitis Acetylation 32305562
K 341 D Renal fibrosis Acetylation 37777567
K 378 D Nonalcoholic steatohepatitis Acetylation 32305562
K 378 D Renal fibrosis Acetylation 37777567
K 20 U Triple-negative breast cancer Acetylation 34392614
K 117 U Triple-negative breast cancer Acetylation 34392614
K 333 U Melanoma Acetylation 29520103
K 53 U Cancer Methylation 35085106
K 333 U Cancer Methylation 35085106
T 179 U Breast cancer Phosphorylation 33051597
S 213 U Prostate cancer Phosphorylation 36536346

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: