| Id: | acc0788 |
| Group: | 2sens |
| Protein: | FOXO3a |
| Gene Symbol: | FOXO3 |
| Protein Id: | O43524 |
| Protein Name: | FOXO3_HUMAN |
| PTM: | phosphorylation |
| Site: | Thr32 |
| Site Sequence: | EPQSRPRSCTWPLQRPELQAS |
| Disease Category: | Cancer |
| Disease: | Hepatocellular Carcinoma |
| Disease Subtype: | |
| Disease Cellline: | HepG2 |
| Disease Info: | |
| Drug: | As(2)O(3) |
| Drug Info: | Arsenic trioxide (As?O?) is a chemotherapeutic agent primarily used in the treatment of acute promyelocytic leukemia (APL). |
| Effect: | modulate |
| Effect Info: | "Treatment of HCC cell line HepG2 with As?O? reduces the phosphorylation of FOXO3a at the Thr?? residue, thereby inhibiting tumor growth." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 18937079 |
| Sentence Index: | 18937079_7-8 |
| Sentence: | "Western blotting revealed that treatment HCC cells HepG2 with As(2)O(3) resulted in the increasing of FOXO3a expression and triggered phosphorylation of FOXO3a at the Thr(32) residue decrease. This FOXO3a accumulation correlated well with the As(2)O(3)-induced reduction of active Akt. Nuclear and cytoplasmic protein extracts isolated from the HCC cell line HepG2 revealed that the amount of nuclear FOXO3a was increased by treatment with As(2)O(3), whereas the amount of cytoplasmic FOXO3a was decreased." |
Sequence & Structure:
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSSSASLSPSVSKPCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSHSDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQGALGGSRALSNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTAC| FOXO3-Thr32 | |
|---|---|
| Cancer | Intensity |
| BRCA | |
| COAD | |
| HGSC | |
| ccRCC | |
| GBM | |
| HNSC | |
| LUAD | |
| LUSC | |
| non_ccRCC | |
| PDAC | |
| UCEC | |
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| T | 32 | U | Breast cancer | Phosphorylation | 36797347 |
| T | 32 | U | Non-small cell lung cancer | Phosphorylation | 35459265 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptM| Protein | Gene | PTM | Position | Modified sequence | Cell | Drug | pEC50 | Regulation | Experiment |
|---|---|---|---|---|---|---|---|---|---|
| O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAK | A431 | Dasatinib | 5.9597 | down | |
| O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAK | A431 | Gefitinib | 5.4679 | down | |
| O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAK | A431 | Gefitinib | 4.9989 | down | |
| O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGR | A431 | Dasatinib | 6.2182 | - | |
| O43524 | FOXO3 | P | Thr32;Ser43 | SCT(ph)WPLQRPELQAS(ph)PAKPSGETAADSMIPEEEDDEDDEDGGGR | A431 | Dasatinib | 4.3461 | - | |
| O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGR | A431 | Dasatinib | 4.4676 | - | |
| O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAK | A431 | Dasatinib | 7.2352 | - | |
| O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGR | A431 | Dasatinib | 7.1471 | - | |
| O43524 | FOXO3 | P | Thr32;Ser43 | SCT(ph)WPLQRPELQAS(ph)PAKPSGETAADSMIPEEEDDEDDEDGGGR | A431 | Dasatinib | 8.5156 | - | |
| O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGR | A431 | Dasatinib | 5.8468 | - | |
| O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGR | A431 | Gefitinib | 6.093 | - | |
| O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAK | A431 | Gefitinib | 6.3386 | - | |
| O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGR | A431 | Gefitinib | 5.744 | - |
pEC50 Note: pEC50 is the negative logarithm of EC50 (half-maximal effective concentration, dosage unit Mol), calculated as pEC50 = -log10(EC50), which quantifies the potency of a drug or compound.
Function score:
source: funscoRNo data.
