| Id: | acc1065 |
| Group: | 2sens |
| Protein: | histone H3 |
| Gene Symbol: | H3C1 |
| Protein Id: | P68431 |
| Protein Name: | H31_HUMAN |
| PTM: | methylation |
| Site: | Lys9 |
| Site Sequence: | -MARTKQTARKSTGGKAPRKQ |
| Disease Category: | Cancer |
| Disease: | Prostate Cancer |
| Disease Subtype: | |
| Disease Cellline: | PC3 |
| Disease Info: | |
| Drug: | genistein |
| Drug Info: | "Genistein is a naturally occurring isoflavone with demonstrated antiproliferative effects on various cancer cells, including hepatocellular carcinoma, lung cancer, and ovarian cancer, by inducing cell cycle arrest and apoptosis, and has potential applications in hepatoprotective agents against chemical-induced liver injury." |
| Effect: | modulate |
| Effect Info: | "Genistein reactivates the tumor suppressor genes silenced in prostate cancer cells by regulating the methylation and acetylation of histone H3-K9, thereby inhibiting the PI3K/AKT and NF-κB signaling pathways and suppressing tumor growth and metastasis." |
| Note: | retraction |
| Score: | 3.0 |
| Pubmed(PMID): | 18431742 |
| Sentence Index: | 18431742_4-5 |
| Sentence: | "We report here that genistein activates TSGs through remodeling of the heterochromatic domains at promoters in prostate cancer cells by modulating histone H3-Lysine 9 (H3-K9) methylation and deacetylation. Genistein activation involved demethylation and acetylation of H3-K9 at the PTEN and the CYLD promoter, while acetylation of H3-K9 at the p53 and the FOXO3a promoter occurred through reduction of endogenous SIRT1 activity." |
Sequence & Structure:
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| K | 9 | D | Diabetes mellitus | Acetylation | 23423566 |
| K | 9 | D | Friedreich's ataxia | Acetylation | 18045775 |
| K | 9 | D | Prostate cancer | Acetylation | 19885564 |
| K | 9 | D | Systemic lupus erythematosus | Acetylation | 36165173 |
| K | 9 | D | Prostate cancer | Methylation | 19739128 |
| K | 9 | D | Pancreatic carcinoma | Methylation | 20142597 |
| K | 9 | U | Prostate cancer | Acetylation | 19935671 |
| K | 9 | U | Diabetes mellitus | Acetylation | 23423566 |
| K | 9 | U | Gastric adenocarcinoma | Acetylation | 18470569 |
| K | 9 | U | Type 2 diabetes | Acetylation | 34944721 |
| K | 9 | U | Breast cancer | Methylation | 19943104 |
| K | 9 | U | Friedreich's ataxia | Methylation | 18045775 |
| K | 9 | U | Friedreich's ataxia | Methylation | 18045775 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
