| Id: | acc1135 |
| Group: | 2sens |
| Protein: | 4EBP1 |
| Gene Symbol: | EIF4EBP1 |
| Protein Id: | Q13541 |
| Protein Name: | 4EBP1_HUMAN |
| PTM: | phosphorylation |
| Site: | Thr70 |
| Site Sequence: | ECRNSPVTKTPPRDLPTIPGV |
| Disease Category: | Cancer |
| Disease: | Gastric Cancer |
| Disease Subtype: | |
| Disease Cellline: | MKN45 |
| Disease Info: | |
| Drug: | 5-aza |
| Drug Info: | "5-aza, also known as 5-azacytidine, is a chemical compound used in the treatment of certain hematological diseases, notably myelodysplastic syndromes, and acts by inhibiting DNA methylation." |
| Effect: | inhibit |
| Effect Info: | "In cells treated with LY294002 or RAPA, the phosphorylation of Akt, p70S6K, and 4E - BP1 was significantly reduced, enhancing the effects of 5 - aza - dC on cell proliferation and cell cycle arrest in human gastric cancer cell lines." |
| Note: | |
| Score: | 5.0 |
| Pubmed(PMID): | 18622747 |
| Sentence Index: | 18622747_10-11 |
| Sentence: | "Phosphorylation of Akt, p70S6K and 4E-BP1 were significantly reduced in the cells treated with LY294002 or RAPA (P<0.01), but we failed to find that 5-aza-dC enhance these effects. We suggested that mTOR inhibition could enhance the effects of 5-aza-dC on suppressing cell proliferation and arresting cell cycle in human gastric cancer cell lines, which might be a potential target for tumor therapy." |
Sequence & Structure:
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTAC| EIF4EBP1-Thr70 | |
|---|---|
| Cancer | Intensity |
| BRCA | -0.163 |
| COAD | -0.958 |
| HGSC | 0.236 |
| ccRCC | 0.368 |
| GBM | 0.971 |
| HNSC | 0.887 |
| LUAD | 0.075 |
| LUSC | 0.183 |
| non_ccRCC | -2.352 |
| PDAC | |
| UCEC | 0.753 |
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| T | 70 | P | Acute myeloid leukemia/acute myelogenous leukemia | Phosphorylation | 18056483 |
| T | 70 | P | Intrahepatic cholangiocarcinoma | Phosphorylation | 22248270 |
| T | 70 | P | Rhabdomyosarcoma | Phosphorylation | 16790088 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptM| Protein | Gene | PTM | Position | Modified sequence | Cell | Drug | pEC50 | Regulation | Experiment |
|---|---|---|---|---|---|---|---|---|---|
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | A431 | Dasatinib | 6.0195 | up | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | A549 | Staursporin | 5.9252 | up | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPR | A431 | Afatinib | 8.7928 | down | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | A431 | Afatinib | 7.9835 | down | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | A431 | Afatinib | 8.6179 | down | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | A431 | Gefitinib | 6.7587 | down | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | A431 | Gefitinib | 6.3572 | down | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | BT-474 | Lapatinib | 6.824 | down | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | BT-474 | Lapatinib | 6.7529 | down | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | MDA-MB-175 | Lapatinib | 6.6884 | down | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | PC-9 | AZD4547 | 5.035 | down | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 8.419 | down | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | RPMI8226 | BTZ | 8.3002 | down | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | RPMI8226 | BTZ | 8.2831 | down | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | RPMI8226 | BTZ | 8.07 | down | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | RPMI8226 | BTZ | 8.0133 | down | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 7.7252 | down | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 7.6381 | down | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser96 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQS(ph)HLRNSPEDKR | RPMI8226 | BTZ | 8.2714 | down | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | RPMI8226 | BTZ | 8.0173 | down | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | RPMI8226 | BTZ | 7.9856 | down | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDK | RPMI8226 | BTZ | 7.9312 | down | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDK | RPMI8226 | BTZ | 7.9131 | down | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | RPMI8226 | BTZ | 7.9082 | down | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser96 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQS(ph)HLRNSPEDKR | RPMI8226 | BTZ | 7.7071 | down | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | RPMI8226 | BTZ | 7.5867 | down | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | RPMI8226 | BTZ | 8.2907 | down | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 8.2867 | down | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | RPMI8226 | BTZ | 8.1003 | down | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | SK-BR-3 | Lapatinib | 8.4795 | down | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | A431 | Afatinib | 7.8898 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A431 | Afatinib | 9.1783 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | A431 | Afatinib | 8.1777 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPR | A431 | Afatinib | 7.7482 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | A431 | Afatinib | 6.0202 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | A431 | Afatinib | 8.2975 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A431 | Afatinib | 8.4624 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPR | A431 | Afatinib | 8.2529 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | A431 | Afatinib | 8.0296 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | A431 | Afatinib | 8.0027 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A431 | Dasatinib | 9.9348 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPR | A431 | Dasatinib | 8.9776 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser83 | T(ph)PPRDLPTIPGVTS(ph)PSSDEPPMEASQSHLR | A431 | Dasatinib | 8.9298 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | A431 | Dasatinib | 8.7547 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A431 | Dasatinib | 6.5841 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | A431 | Dasatinib | 5.7657 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPR | A431 | Dasatinib | 5.6016 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | A431 | Dasatinib | 4.4178 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | A431 | Dasatinib | 2 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDKR | A431 | Dasatinib | 2 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPR | A431 | Dasatinib | 9.6079 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A431 | Dasatinib | 6.2452 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | A431 | Dasatinib | 6.0483 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | A431 | Dasatinib | 5.7177 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | A431 | Dasatinib | 6.9124 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | A431 | Dasatinib | 5.4322 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | A431 | Dasatinib | 15.946 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A431 | Dasatinib | 6.7672 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | A431 | Dasatinib | 2 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPR | A431 | Gefitinib | 7.0346 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | A431 | Gefitinib | 2 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A431 | Gefitinib | 6.9928 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | A431 | Gefitinib | 6.5615 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPR | A431 | Gefitinib | 6.446 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | A431 | Gefitinib | 2 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | A431 | Gefitinib | 5.6604 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | A431 | Gefitinib | 7.8332 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | A431 | Gefitinib | 6.7697 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A431 | Imatinib | 10.4088 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | A431 | Imatinib | 9.4099 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDKR | A431 | Imatinib | 9.2795 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A431 | Imatinib | 9.2295 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | A431 | Imatinib | 9.1512 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | A431 | Imatinib | 7.2923 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | A431 | Imatinib | 5.2936 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A459 | MK2206 | 6.2769 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A459 | MK2206 | 4.0675 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A459 | Selumetinib | 6.2512 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A459 | Selumetinib | 5.3539 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A459 | SelumetinibMK2206-1to2 | 6.7495 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A459 | SelumetinibMK2206-3to1 | 6.923 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A549 | AZD8055 | 8.4148 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | A549 | AZD8055 | 7.0069 | - | |
| Q13541 | EIF4EBP1 | P | Thr68;Thr70 | NSPVT(ph)KT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A549 | Dasatinib | 13.2172 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | A549 | Dasatinib | 6.7617 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | A549 | Dasatinib | 6.2204 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A549 | Dasatinib | 5.7695 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPR | A549 | Dasatinib | 2 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | A549 | MK2206 | 6.0516 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A549 | MK2206 | 5.689 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | A549 | PD325901 | 11.1261 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A549 | PD325901 | 10.5992 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | A549 | PD325901 | 7.3358 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPR | A549 | PD325901 | 6.7347 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | A549 | Pictilisib | 6.6838 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPR | A549 | Refametinib | 10.978 | - | |
| Q13541 | EIF4EBP1 | P | Thr68;Thr70 | NSPVT(ph)KT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A549 | Refametinib | 7.782 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A549 | Refametinib | 7.4687 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | A549 | Refametinib | 2 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A549 | Staursporin | 6.671 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | A549 | Staursporin | 4.5701 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | A549 | Tideglusib | 10.9176 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | A549 | Tideglusib | 9.7845 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | A549 | Tideglusib | 5.8981 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | ARH-77 | Rituximab | -3.8921 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | ARH-77 | Rituximab | -0.5178 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | ARH-77 | Rituximab | -3.6705 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | ARH-77 | Rituximab | -3.7993 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser83 | T(ph)PPRDLPTIPGVTS(ph)PSSDEPPMEASQSHLR | ARH-77 | Rituximab | -3.6593 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | ARH-77 | Rituximab | -3.8799 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | ARH-77 | Rituximab | -3.4351 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | ARH-77 | Rituximab | -4.2563 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | ARH-77 | Rituximab | -3.7092 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser83 | T(ph)PPRDLPTIPGVTS(ph)PSSDEPPMEASQSHLR | ARH-77 | Rituximab | -3.7539 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | ARH-77 | Rituximab | -3.7692 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | ARH-77 | Rituximab | -4.1665 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | ARH-77 | Rituximab | -4.4144 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | ARH-77 | Rituximab | -2.3246 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | ARH-77 | Rituximab | -1.2211 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | ARH-77 | Rituximab | -3.4676 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | ARH-77 | Rituximab | -4.182 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser83 | T(ph)PPRDLPTIPGVTS(ph)PSSDEPPMEASQSHLR | ARH-77 | Rituximab | -4.2069 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | BT-474 | Lapatinib | 6.7669 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDKR | BT-474 | Lapatinib | 6.7612 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDK | BT-474 | Lapatinib | 6.7597 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | BT-474 | Lapatinib | 6.145 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser83 | T(ph)PPRDLPTIPGVTS(ph)PSSDEPPMEASQSHLR | BT-474 | Lapatinib | 5.5227 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | BT-474 | Pertuzumab | 1.5175 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | BT-474 | Pertuzumab | 0.6374 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | BT-474 | Pertuzumab | -1.5238 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser83 | T(ph)PPRDLPTIPGVTS(ph)PSSDEPPMEASQSHLR | BT-474 | Pertuzumab | -2.7671 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDKR | BT-474 | Pertuzumab | -4.0075 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | BT-474 | Pertuzumab | -4.2089 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser83 | T(ph)PPRDLPTIPGVTS(ph)PSSDEPPMEASQSHLR | BT-474 | Trastuzumab | -2.2386 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | BT-474 | Trastuzumab | -2.492 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | BT-474 | Trastuzumab | -3.9294 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDKR | BT-474 | Trastuzumab | -3.9576 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | BT-474 | Trastuzumab | -4.7417 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | BT-474 | Trastuzumab | -4.7462 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser96 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQS(ph)HLRNSPEDK | BT-474 | Trastuzumab | -4.8433 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDK | BT-474 | Trastuzumab | -6.0023 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | HeLa | A485 | 11.0426 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser96 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQS(ph)HLRNSPEDKR | HeLa | A485 | 10.6961 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDK | HeLa | A485 | 7.2502 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82;Ser96 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQS(ph)HLRNSPEDKR | HeLa | A485 | 6.9672 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDKR | HeLa | A485 | 6.7479 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser96 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQS(ph)HLRNSPEDK | HeLa | A485 | 6.2675 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDK | HeLa | A485 | 6.2419 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPR | HeLa | A485 | 5.7473 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | HeLa | A485 | 5.522 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | HeLa | A485 | 5.2941 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | HeLa | A485 | 5.263 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser83 | T(ph)PPRDLPTIPGVTS(ph)PSSDEPPMEASQSHLR | HeLa | A485 | 5.2614 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82;Ser94 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEAS(ph)QSHLRNSPEDKR | HeLa | A485 | 5.2591 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | HeLa | A485 | 3.9823 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | HeLa | A486 | 14 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82;Ser94 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEAS(ph)QSHLRNSPEDKR | HeLa | A486 | 8.4193 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | HeLa | A486 | 6.3828 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDK | HeLa | A486 | 5.9829 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | HeLa | A486 | 5.2384 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | HeLa | A486 | 5.2322 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPR | HeLa | A486 | 4.9635 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser85 | T(ph)PPRDLPTIPGVTSPS(ph)SDEPPMEASQSHLR | HeLa | CUDC101 | 9.2459 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | K562 | Cytarabine | 7.5085 | - | |
| Q13541 | EIF4EBP1 | P | Thr68;Thr70 | FLMECRNSPVT(ph)KT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | K562 | Cytarabine | 5.7006 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLRNSPEDKR | K562 | Dasatinib | 13.984 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | K562 | Dasatinib | 11.2687 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | K562 | Dasatinib | 10.4187 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDK | K562 | Dasatinib | 10.3508 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | K562 | Dasatinib | 9.8538 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | K562 | Dasatinib | 9.7516 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDK | K562 | Dasatinib | 9.3996 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | K562 | Dasatinib | 9.2716 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | K562 | Dasatinib | 9.2583 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | K562 | Dasatinib | 9.2572 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | K562 | Dasatinib | 9.1016 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | K562 | Dasatinib | 9.0369 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPR | K562 | Dasatinib | 8.9997 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | K562 | Dasatinib | 8.9932 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDK | K562 | Dasatinib | 8.7786 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPR | K562 | Dasatinib | 8.6384 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser96 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQS(ph)HLRNSPEDKR | K562 | Dasatinib | 8.2647 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | K562 | Dasatinib | 8.2252 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPR | K562 | Dasatinib | 4 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | K562 | Dasatinib | 2 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | K562 | Dasatinib | 2 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | K562 | Dasatinib | 13.287 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDK | K562 | Dasatinib | 13.0036 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser96 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQS(ph)HLRNSPEDKR | K562 | Dasatinib | 12.2142 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | K562 | Dasatinib | 10.9039 | - | |
| Q13541 | EIF4EBP1 | P | Thr68;Thr70 | NSPVT(ph)KT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | K562 | Dasatinib | 10.8608 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | K562 | Dasatinib | 10.7804 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDKR | K562 | Dasatinib | 10.7636 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDKR | K562 | Dasatinib | 10.76 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | K562 | Dasatinib | 10.754 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser83 | T(ph)PPRDLPTIPGVTS(ph)PSSDEPPMEASQSHLR | K562 | Dasatinib | 9.7122 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | K562 | Dasatinib | 9.4529 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | K562 | Dasatinib | 9.3072 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | K562 | Dasatinib | 9.2663 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDK | K562 | Dasatinib | 8.7648 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | K562 | Dasatinib | 5.3405 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | K562 | Dasatinib | 4 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | K562 | Dasatinib | 9.7595 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDKR | K562 | Dasatinib | 9.7335 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | K562 | Dasatinib | 9.4475 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | K562 | Dasatinib | 9.3867 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | K562 | Dasatinib | 9.2582 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPR | K562 | Dasatinib | 9.2055 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | K562 | Dasatinib | 9.1783 | - | |
| Q13541 | EIF4EBP1 | P | Thr68;Thr70 | NSPVT(ph)KT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | K562 | Dasatinib | 9.0107 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPR | K562 | Dasatinib | 8.9845 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser96 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQS(ph)HLRNSPEDKR | K562 | Dasatinib | 8.983 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDKR | K562 | Dasatinib | 8.9423 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | K562 | Dasatinib | 8.8921 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | K562 | Dasatinib | 8.8111 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | K562 | Dasatinib | 8.7536 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDK | K562 | Dasatinib | 8.4889 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | K562 | Dasatinib | 7.7743 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDK | K562 | Dasatinib | 6.5444 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | K562 | Imatinib | 11.7532 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70;Ser94 | NS(ph)PVTKT(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDK | K562 | Imatinib | 10.0289 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser96 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQS(ph)HLRNSPEDK | K562 | Imatinib | 9.6823 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser83 | T(ph)PPRDLPTIPGVTS(ph)PSSDEPPMEASQSHLR | K562 | Imatinib | 9.5417 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | K562 | Imatinib | 9.3442 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | K562 | Imatinib | 9.3385 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPR | K562 | Imatinib | 7.2635 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | K562 | Paclitaxel | 15 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | KYSE-520 | SHP099 | 6.7238 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | MDA-MB-175 | Lapatinib | 6.2836 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | MDA-MB-175 | Lapatinib | 5.3363 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser96 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQS(ph)HLRNSPEDKR | MDA-MB-175 | Pertuzumab | -3.0435 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDKR | MDA-MB-175 | Pertuzumab | -3.1907 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | MDA-MB-175 | Pertuzumab | -3.2457 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDKR | MDA-MB-175 | Trastuzumab | -3.2394 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | MDA-MB-175 | Trastuzumab | -3.2562 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | MDA-MB-175 | Trastuzumab | -5.2329 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | PC-9 | AZD4547 | 6.2575 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | PC-9 | Gefitinib | 6.324 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | PC-9 | GeftinibAZD4547-1to80 | 8.2599 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | PC-9 | Lapatinib | 6.6757 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | PC-9 | Lapatinib | 5.2339 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | PC-9 | LapatinibAZD4547 | 7.5167 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | Ramos | Rituximab | -1.2657 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | Ramos | Rituximab | -2.7165 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | Ramos | Rituximab | -3.2014 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDK | Ramos | Rituximab | -3.2111 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | Ramos | Rituximab | -3.4836 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | Ramos | Rituximab | -2.2435 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | Ramos | Rituximab | -2.2459 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | Ramos | Rituximab | -2.5832 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | Ramos | Rituximab | -2.5976 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDK | Ramos | Rituximab | -3.0312 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | Ramos | Rituximab | -3.7183 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDK | Ramos | Rituximab | -4.6263 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | Ramos | Rituximab | -1.2319 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | Ramos | Rituximab | -1.3498 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDK | Ramos | Rituximab | -2.7709 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | Ramos | Rituximab | -3.039 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | Ramos | Rituximab | -2.2222 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDK | Ramos | Rituximab | -2.2472 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | Ramos | Rituximab | -2.2522 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | Ramos | Rituximab | -2.4891 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | Ramos | Rituximab | -0.7907 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDK | Ramos | Rituximab | -0.8817 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | Ramos | Rituximab | -1.0972 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser96 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQS(ph)HLRNSPEDKR | Ramos | Rituximab | -2.1958 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | Ramos | Rituximab | -2.2089 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDK | Ramos | Rituximab | -2.4646 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | Ramos | Rituximab | -1.994 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDK | Ramos | Rituximab | -2.08 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | Ramos | Rituximab | -2.1539 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | Ramos | Rituximab | -2.2764 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | Ramos | Rituximab | -2.434 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 8.2799 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 7.5018 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 7.4231 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 9.8941 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 8.7326 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 8.2585 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 6.5225 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser96 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQS(ph)HLRNSPEDK | RPMI8226 | BTZ | 13.2034 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | RPMI8226 | BTZ | 12.1701 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | RPMI8226 | BTZ | 10.8347 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser96 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQS(ph)HLRNSPEDK | RPMI8226 | BTZ | 8.6664 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 8.3912 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | RPMI8226 | BTZ | 7.9182 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 7.7239 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 7.4271 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 7.3094 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | RPMI8226 | BTZ | 6.4146 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 15.0033 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 8.7506 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 8.4777 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 8.1479 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 8.5309 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser83 | T(ph)PPRDLPTIPGVTS(ph)PSSDEPPMEASQSHLR | RPMI8226 | BTZ | 7.6804 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 7.4406 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | RPMI8226 | BTZ | 7.3257 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser83 | T(ph)PPRDLPTIPGVTS(ph)PSSDEPPMEASQSHLR | RPMI8226 | BTZ | 6.7008 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | SK-BR-3 | Lapatinib | 8.5609 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser96 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQS(ph)HLRNSPEDKR | SK-BR-3 | Lapatinib | 8.5148 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDKR | SK-BR-3 | Lapatinib | 8.4543 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | SK-BR-3 | Lapatinib | 7.6936 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | SK-BR-3 | Lapatinib | 7.2664 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | SK-BR-3 | Lapatinib | 6.6167 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | SK-BR-3 | Lapatinib | 6.2644 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | SK-BR-3 | Lapatinib | 5.4036 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | SK-BR-3 | Pertuzumab | 5 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | SK-BR-3 | Pertuzumab | 5 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDK | SK-BR-3 | Pertuzumab | 5 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDKR | SK-BR-3 | Pertuzumab | 5 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | SK-BR-3 | Pertuzumab | -1.0812 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDK | SK-BR-3 | Pertuzumab | -2.9936 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | SK-BR-3 | Pertuzumab | -4.7454 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | SK-BR-3 | Pertuzumab | -7.0183 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPR | SK-BR-3 | Trastuzumab | 2.3871 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | SK-BR-3 | Trastuzumab | 1.2723 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | SK-BR-3 | Trastuzumab | -1.5757 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | FLMECRNS(ph)PVTKT(ph)PPR | SK-BR-3 | Trastuzumab | -1.9038 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | SK-BR-3 | Trastuzumab | -2.018 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDKR | SK-BR-3 | Trastuzumab | -2.0283 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | NSPVTKT(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | SK-BR-3 | Trastuzumab | -2.2013 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | SK-BR-3 | Trastuzumab | -4.4659 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDKR | SU-DHL-4 | Rituximab | 1.1205 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser96 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQS(ph)HLRNSPEDKR | SU-DHL-4 | Rituximab | -0.6414 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | SU-DHL-4 | Rituximab | -1.3481 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | SU-DHL-4 | Rituximab | -1.4368 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | SU-DHL-4 | Rituximab | -1.5065 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | SU-DHL-4 | Rituximab | -1.4511 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | SU-DHL-4 | Rituximab | -1.5579 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDK | SU-DHL-4 | Rituximab | -1.6141 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser101 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDKR | SU-DHL-4 | Rituximab | -1.6748 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | SU-DHL-4 | Rituximab | -1.7258 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser83 | T(ph)PPRDLPTIPGVTS(ph)PSSDEPPMEASQSHLR | SU-DHL-4 | Rituximab | -1.8648 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | SU-DHL-4 | Rituximab | -3.0503 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | SU-DHL-4 | Rituximab | 2.9682 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDK | SU-DHL-4 | Rituximab | 1.8831 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | SU-DHL-4 | Rituximab | -1.4388 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDKR | SU-DHL-4 | Rituximab | -2.8524 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | SU-DHL-4 | Rituximab | -4.2431 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | SU-DHL-4 | Rituximab | -1.4839 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | SU-DHL-4 | Rituximab | -2.1107 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser83 | T(ph)PPRDLPTIPGVTS(ph)PSSDEPPMEASQSHLR | SU-DHL-4 | Rituximab | -2.7426 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | SU-DHL-4 | Rituximab | -2.9349 | - | |
| Q13541 | EIF4EBP1 | P | Ser65;Thr70 | NS(ph)PVTKT(ph)PPR | SU-DHL-4 | Rituximab | -1.6553 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDK | SU-DHL-4 | Rituximab | -1.7434 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | SU-DHL-4 | Rituximab | -2.4206 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | SU-DHL-4 | Rituximab | -2.9562 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | SU-DHL-4 | Rituximab | -1.4894 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser94 | T(ph)PPRDLPTIPGVTSPSSDEPPMEAS(ph)QSHLRNSPEDK | SU-DHL-4 | Rituximab | -3.4645 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | SU-DHL-4 | Rituximab | -3.0867 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Ser83 | T(ph)PPRDLPTIPGVTS(ph)PSSDEPPMEASQSHLR | SU-DHL-4 | Rituximab | -2.7442 | - | |
| Q13541 | EIF4EBP1 | P | Thr70;Thr82 | T(ph)PPRDLPTIPGVT(ph)SPSSDEPPMEASQSHLR | SU-DHL-4 | Rituximab | -2.9656 | - | |
| Q13541 | EIF4EBP1 | P | Thr70 | T(ph)PPRDLPTIPGVTSPSSDEPPMEASQSHLR | SU-DHL-4 | Rituximab | -2.9963 | - |
pEC50 Note: pEC50 is the negative logarithm of EC50 (half-maximal effective concentration, dosage unit Mol), calculated as pEC50 = -log10(EC50), which quantifies the potency of a drug or compound.
Function score:
source: funscoRNo data.
