PMADS

Id:	acc1200
Group:	2sens
Protein:	Bax
Gene Symbol:	BAX
Protein Id:	Q07812
Protein Name:	BAX_HUMAN
PTM:	phosphorylation
Site:	Ser184
Site Sequence:	IFVAGVLTASLTIWKKMG---
Disease Category:	Cancer
Disease:	Lung Cancer
Disease Subtype:	NSCLC
Disease Cellline:	A549
Disease Info:
Drug:	okadaic acid (OA)
Drug Info:	"Okadaic acid (OA) is a polyether marine biotoxin that inhibits protein phosphatases, leading to diarrhetic shellfish poisoning (DSP) and primarily found in dinoflagellates and contaminated shellfish."
Effect:	modulate
Effect Info:	Treatment of cells with okadaic acid or expression of small T antigen can lead to Bax phosphorylation and enhance cell survival.
Note:
Score:	4.0
Pubmed(PMID):	16679323
Sentence Index:	16679323_2-3
Sentence:	"We have recently discovered that Bax phosphorylation at serine 184 induced by nicotine through activation of protein kinase AKT abolishes its proapoptotic function in human lung cancer cells. Here we found that either treatment of cells with the protein phosphatase 2A (PP2A) inhibitor okadaic acid or specific disruption of PP2A activity by expression of SV40 small tumor antigen enhanced Bax phosphorylation, whereas C(2)-ceramide, a potent PP2A activator, reduced nicotine-induced Bax phosphorylation, suggesting that PP2A may function as a physiological Bax phosphatase. Treatment of Cells with Okadaic Acid or Expression of Small T Antigen Results in Bax Phosphorylation and Enhanced Cell Survival."

Sequence & Structure:

MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

Small molecule

Antibody

PROTAC

Other modalities

Approved Drug

Advanced Clinical

Phase 1 Clinical

Structure with Ligand

High-Quality Ligand

High-Quality Pocket

Med-Quality Pocket

Druggable Family

Approved Drug

Advanced Clinical

Phase 1 Clinical

UniProt loc high conf

GO CC high conf

UniProt loc med conf

UniProt SigP or TMHMM

GO CC med conf

Human Protein Atlas loc

Approved Drug

Advanced Clinical

Phase 1 Clinical

Literature

UniProt Ubiquitination

Database Ubiquitination

Half-life Data

Small Molecule Binder

Approved Drug

Advanced Clinical

Phase 1 Clinical

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

Residue	Position	State	Disease	Class	PMID
-	-	U	Gastric cancer	Ubiquitination	37697039

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links:

CTD
DMRdb