Id: acc1225
Group: 2sens
Protein: c-Jun
Gene Symbol: JUN
Protein Id: P05412
Protein Name: JUN_HUMAN
PTM: phosphorylation
Site: Ser63
Site Sequence: RAKNSDLLTSPDVGLLKLASP
Disease Category: Cancer
Disease: Gastric Cancer
Disease Subtype:
Disease Cellline: NUGC-3
Disease Info:
Drug: Cisplatin
Drug Info: "Cisplatin is a platinum-based chemotherapeutic agent widely used in the treatment of various malignancies, including ovarian, bladder, testicular, and non-small cell lung cancers, by forming DNA cross-links to interfere with replication and repair, thereby inhibiting cancer cell growth and proliferation."
Effect: modulate
Effect Info: Cisplatin sensitivity is associated with enhanced phosphorylation of p38 and c-Jun in GC cell lines.
Note:
Score: 4.0
Pubmed(PMID): 35922477
Sentence Index:
Sentence:

Sequence & Structure:

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets
Small molecule
Antibody
PROTAC
Other modalities
Approved Drug
Advanced Clinical
Phase 1 Clinical
Structure with Ligand
High-Quality Ligand
High-Quality Pocket
Med-Quality Pocket
Druggable Family
Approved Drug
Advanced Clinical
Phase 1 Clinical
UniProt loc high conf
GO CC high conf
UniProt loc med conf
UniProt SigP or TMHMM
GO CC med conf
Human Protein Atlas loc
Approved Drug
Advanced Clinical
Phase 1 Clinical
Literature
UniProt Ubiquitination
Database Ubiquitination
Half-life Data
Small Molecule Binder
Approved Drug
Advanced Clinical
Phase 1 Clinical

PTM Intensity:

source: CPTAC
JUN-Ser63
Cancer Intensity
BRCA 1.609
COAD 0.646
HGSC -1.055
ccRCC -0.135
GBM 0.213
HNSC 0.386
LUAD 0.368
LUSC 0.672
non_ccRCC -1.809
PDAC 0.393
UCEC -1.287

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
S 63 D Hepatocellular carcinoma Phosphorylation 34408980
S 63 U Colorectal cancer Phosphorylation 21296766
S 63 U Diabetes mellitus Phosphorylation 37261387
S 63 U Squamous cell carcinoma Phosphorylation 23752190
S 63 U Alzheimer's disease Phosphorylation 28814543
S 63 U Glioblastoma Phosphorylation 35567901

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM
Protein Gene PTM Position Modified sequence Cell Drug pEC50 Regulation Experiment
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK RPMI8226 BTZ 8.5442 up
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK RPMI8226 BTZ 6.2757 up
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK RPMI8226 BTZ 7.1608 up
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK RPMI8226 BTZ 7.6363 up
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK RPMI8226 BTZ 7.7582 up
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK RPMI8226 BTZ 7.0865 up
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK RPMI8226 BTZ 7.1209 up
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK RPMI8226 BTZ 7.9114 up
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK BT-474 Lapatinib 6.7014 down
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK K562 Dasatinib 5.7499 down
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A549 Dasatinib 6.0402 down
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK BT-474 Pertuzumab -2.2395 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK KYSE-520 SHP099 6.3337 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK ARH-77 Rituximab -3.2436 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK BT-474 Trastuzumab -3.1296 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK HeLa A485 6.2664 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK ARH-77 Rituximab -1.2221 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK K562 Dasatinib 10.274 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK K562 Dasatinib 6.9203 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK ARH-77 Rituximab -1.2524 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK K562 Dasatinib 10.7829 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK K562 Dasatinib 7.1477 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK K562 Dasatinib 8.9853 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK ARH-77 Rituximab -3.7446 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK RPMI8226 BTZ 6.7447 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK RPMI8226 BTZ 6.68 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK SK-BR-3 Lapatinib 7.5842 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK SK-BR-3 Pertuzumab -2.2574 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK SK-BR-3 Trastuzumab 1.7685 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A549 Dactolisib 2 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A431 Afatinib 8.5481 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A431 Afatinib 8.9986 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A431 Afatinib 8.7541 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A431 Dasatinib 5.9509 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A431 Dasatinib 5.6052 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A431 Dasatinib 5.6897 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A431 Dasatinib 8.3558 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A431 Dasatinib 5.5754 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A431 Gefitinib 8.2569 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A431 Gefitinib 7.7361 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A431 Gefitinib 8.3707 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A431 Imatinib 6.8027 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A549 AZD8055 7.2624 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A431 Afatinib 5.8259 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A549 Dasatinib 6.1952 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A549 MK2206 3.9339 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A549 Nintedanib 8.511 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A549 PD325901 8.3734 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A549 PD325901 7.6234 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A549 Pictilisib 7.2454 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A549 Refametinib 6.9298 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A549 Staursporin 6.2161 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK A549 Tideglusib 7.7617 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK ARH-77 Rituximab 1.1263 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK ARH-77 Rituximab -3.8753 -
P05412 JUN P Ser63 NSDLLTS(ph)PDVGLLK ARH-77 Rituximab -1.6815 -

pEC50 Note: pEC50 is the negative logarithm of EC50 (half-maximal effective concentration, dosage unit Mol), calculated as pEC50 = -log10(EC50), which quantifies the potency of a drug or compound.

Function score:

source: funscoR

No data.

Cross Links: