Id: | acc1391 |
Group: | 2sens |
Protein: | BCL2 |
Gene Symbol: | BCL2 |
Protein Id: | P10415 |
Protein Name: | BCL2_HUMAN |
PTM: | phosphorylation |
Site: | Ser70 |
Site Sequence: | ASRDPVARTSPLQTPAAPGAA |
Disease Category: | Cancer |
Disease: | Hepatocellular Carcinoma |
Disease Subtype: | |
Disease Cellline: | Bel7404 |
Disease Info: | |
Drug: | oxaliplatin (OXA) |
Drug Info: | "Oxaliplatin (OXA) is a third-generation platinum-based chemotherapeutic agent primarily used in the treatment of colorectal, gastric, pancreatic, and other cancers, which inhibits DNA synthesis by inducing cross-linking damage, thereby blocking replication and transcription and triggering apoptosis." |
Effect: | inhibit |
Effect Info: | "Overexpression of sCLU significantly increases phosphorylated Akt, thereby activating the Akt pathway in hepatocellular carcinoma and leading to oxaliplatin resistance." |
Note: | |
Score: | 5.0 |
Pubmed(PMID): | 23279642 |
Sentence Index: | 23279642_4-5 |
Sentence: | "The stable transfectants that are depleted of or overexpress sCLU and OXA-resistant cells were generated using human HCC cells. Overexpression of sCLU abrogated OXA-induced inhibition of cell growth and cell apoptosis, but depletion of sCLU synergized with OXA to inhibit cell growth and enhance cell apoptosis, by regulating proteins involved in mitochondrial apoptosis pathways, such as Bcl-2, Bax, Bcl-xL and caspase-9, and affecting phosphorylation of Akt and GSK-3beta." |
Sequence & Structure:
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 4 | - | chronic lymphocytic leukemia | EMA DailyMed FDA |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 4 | Not yet recruiting | chronic lymphocytic leukemia | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 4 | - | neoplasm | ATC |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Completed | chronic lymphocytic leukemia | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Not yet recruiting | chronic lymphocytic leukemia | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Recruiting | chronic lymphocytic leukemia | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | chronic lymphocytic leukemia | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | acute myeloid leukemia | ClinicalTrials ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Completed | acute myeloid leukemia | ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Not yet recruiting | acute myeloid leukemia | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | myelodysplastic syndrome | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Recruiting | acute myeloid leukemia | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Terminated | acute myeloid leukemia | ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | childhood acute myeloid leukemia | ClinicalTrials |
BCL2 | OBLIMERSEN SODIUM | Bcl-2 mRNA antisense inhibitor | 3 | Completed | cutaneous melanoma | ClinicalTrials |
BCL2 | OBLIMERSEN SODIUM | Bcl-2 mRNA antisense inhibitor | 3 | Completed | leukemia | ClinicalTrials |
BCL2 | OBATOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Withdrawn | small cell lung carcinoma | ClinicalTrials |
BCL2 | OBATOCLAX MESYLATE | Apoptosis regulator Bcl-2 inhibitor | 3 | Withdrawn | small cell lung carcinoma | ClinicalTrials |
BCL2 | OBLIMERSEN SODIUM | Bcl-2 mRNA antisense inhibitor | 3 | Completed | multiple myeloma | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | multiple myeloma | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Completed | multiple myeloma | ClinicalTrials |
BCL2 | NAVITOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | primary myelofibrosis | ClinicalTrials ClinicalTrials |
BCL2 | OBLIMERSEN SODIUM | Bcl-2 mRNA antisense inhibitor | 3 | Withdrawn | lymphoid leukemia | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Completed | Mantle cell lymphoma | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Recruiting | cancer | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo intensity data of this site,
show all other sites!
BCL2L11-Ser104 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | 0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -0.707 |
BCL2L11-Ser118 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | 0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | -0.707 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L11-Ser77 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.869 | ||||
COAD | |||||
HGSC | 1.655 | ||||
ccRCC | 0.169 | ||||
GBM | |||||
HNSC | 0.422 | ||||
LUAD | 0.134 | ||||
LUSC | -0.138 | ||||
non_ccRCC | 0.29 | ||||
PDAC | |||||
UCEC | -0.663 |
BCL2L11-Ser92 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | -0.707 | ||||
LUAD | 0.707 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L11-Ser93 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | -0.707 | ||||
LUAD | 0.707 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L11-Ser94 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.664 | ||||
COAD | |||||
HGSC | 1.002 | ||||
ccRCC | -0.246 | ||||
GBM | |||||
HNSC | -0.477 | ||||
LUAD | 0.629 | ||||
LUSC | -0.105 | ||||
non_ccRCC | 1.47 | ||||
PDAC | |||||
UCEC | -0.61 |
BCL2L12-Ser113 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.987 | ||||
COAD | |||||
HGSC | |||||
ccRCC | -0.026 | ||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 1.013 |
BCL2L12-Ser121 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.134 | ||||
COAD | |||||
HGSC | 1.006 | ||||
ccRCC | 0.652 | ||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -0.524 |
BCL2L12-Ser194 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | 0.153 | ||||
LUAD | 0.915 | ||||
LUSC | -1.068 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L12-Ser195 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.374 | ||||
COAD | |||||
HGSC | |||||
ccRCC | -1.133 | ||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.759 |
BCL2L12-Ser241 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | -0.993 | ||||
HGSC | |||||
ccRCC | |||||
GBM | 1.084 | ||||
HNSC | -0.554 | ||||
LUAD | 1.075 | ||||
LUSC | -0.613 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L12-Ser242 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | -0.42 | ||||
HGSC | -1.185 | ||||
ccRCC | -0.19 | ||||
GBM | |||||
HNSC | 0.276 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 1.519 |
BCL2L12-Ser272 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | -0.088 | ||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | 0.237 | ||||
LUAD | -1.365 | ||||
LUSC | -0.208 | ||||
non_ccRCC | |||||
PDAC | 1.424 | ||||
UCEC |
BCL2L12-Ser273 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.524 | ||||
COAD | |||||
HGSC | 0.391 | ||||
ccRCC | -1.495 | ||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.58 |
BCL2L12-Thr117 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.35 | ||||
COAD | |||||
HGSC | -1.485 | ||||
ccRCC | 0.687 | ||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.449 |
BCL2L13-Ser288 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | 0.707 | ||||
HNSC | |||||
LUAD | -0.707 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Ser291 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | 0.707 | ||||
HNSC | |||||
LUAD | -0.707 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Ser312 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.693 | ||||
COAD | |||||
HGSC | |||||
ccRCC | 0.081 | ||||
GBM | |||||
HNSC | -0.729 | ||||
LUAD | |||||
LUSC | -0.194 | ||||
non_ccRCC | 1.241 | ||||
PDAC | 0.345 | ||||
UCEC | 0.948 |
BCL2L13-Ser315 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.352 | ||||
COAD | |||||
HGSC | 1.857 | ||||
ccRCC | -0.415 | ||||
GBM | |||||
HNSC | -0.336 | ||||
LUAD | |||||
LUSC | -0.57 | ||||
non_ccRCC | 1.042 | ||||
PDAC | -0.121 | ||||
UCEC | -0.106 |
BCL2L13-Ser327 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | 0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | -0.707 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Ser329 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | 0.787 | ||||
ccRCC | -0.543 | ||||
GBM | |||||
HNSC | -1.095 | ||||
LUAD | |||||
LUSC | -0.447 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 1.298 |
BCL2L13-Ser395 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.707 | ||||
HGSC | -0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Ser420 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | 0.707 | ||||
HNSC | |||||
LUAD | -0.707 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Ser426 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | -0.707 | ||||
HNSC | |||||
LUAD | 0.707 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Ser434 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | -0.729 | ||||
GBM | |||||
HNSC | -0.126 | ||||
LUAD | |||||
LUSC | -0.605 | ||||
non_ccRCC | -0.275 | ||||
PDAC | 1.735 | ||||
UCEC |
BCL2L13-Ser444 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -2.092 | ||||
COAD | 0.9 | ||||
HGSC | -0.546 | ||||
ccRCC | -0.271 | ||||
GBM | |||||
HNSC | -0.516 | ||||
LUAD | |||||
LUSC | 0.329 | ||||
non_ccRCC | 0.352 | ||||
PDAC | 1.271 | ||||
UCEC | 0.573 |
BCL2L13-Ser450 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.476 | ||||
COAD | 1.017 | ||||
HGSC | -1.857 | ||||
ccRCC | -0.033 | ||||
GBM | |||||
HNSC | -0.184 | ||||
LUAD | |||||
LUSC | -0.52 | ||||
non_ccRCC | 1.554 | ||||
PDAC | 0.723 | ||||
UCEC | -0.225 |
BCL2L13-Ser453 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.479 | ||||
HGSC | -1.471 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | 0.735 | ||||
PDAC | |||||
UCEC | 0.256 |
BCL2L13-Ser468 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | -0.707 | ||||
HGSC | 0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Thr429 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | -0.707 | ||||
GBM | |||||
HNSC | 0.707 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Thr431 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | -0.707 | ||||
GBM | |||||
HNSC | 0.707 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L14-Ser135 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.901 | ||||
COAD | 0.578 | ||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | -1.232 | ||||
non_ccRCC | |||||
PDAC | 0.522 | ||||
UCEC | 1.032 |
BCL2L14-Ser44 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | 0.973 |
HGSC | |
ccRCC | |
GBM | |
HNSC | -1.491 |
LUAD | |
LUSC | -0.305 |
non_ccRCC | |
PDAC | 0.857 |
UCEC | -0.034 |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 70 | A | Cancer | Phosphorylation | 32188705 |
S | 70 | U | Lung cancer/carcinoma | Phosphorylation | 23514933 |
S | 70 | U | Prostate cancer | Phosphorylation | 35013120 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.