| Id: | acc1396 |
| Group: | 2sens |
| Protein: | FoxO1 |
| Gene Symbol: | FOXO1 |
| Protein Id: | Q12778 |
| Protein Name: | FOXO1_HUMAN |
| PTM: | phosphorylation |
| Site: | Ser218 |
| Site Sequence: | WKNSIRHNLSLHSKFIRVQNE |
| Disease Category: | Cancer |
| Disease: | Sarcoma |
| Disease Subtype: | angiosarcoma |
| Disease Cellline: | ISO-HAS-B |
| Disease Info: | |
| Drug: | ATM(aPKC inhibitor) |
| Drug Info: | - |
| Effect: | modulate |
| Effect Info: | The drug inhibits the phosphorylation of FoxO1 and reduces proliferation. |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 30559384 |
| Sentence Index: | 30559384_6-7 |
| Sentence: | "We find this pathway is strongly activated in the malignant vascular sarcoma, angiosarcoma, and aPKC inhibition reduces c-Myc expression and proliferation of angiosarcoma cells. Moreover, FoxO1 phosphorylation at Ser218 and aPKC expression correlates with poor patient prognosis." |
Sequence & Structure:
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTAC| FOXO1-Ser218 | |
|---|---|
| Cancer | Intensity |
| BRCA | 1.611 |
| COAD | |
| HGSC | |
| ccRCC | |
| GBM | -0.033 |
| HNSC | |
| LUAD | |
| LUSC | -0.786 |
| non_ccRCC | |
| PDAC | -0.882 |
| UCEC | 0.089 |
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| S | 256 | D | Hepatitis | Phosphorylation | 18316359 |
| T | 24 | D | Head and neck squamous cell carcinoma | Phosphorylation | 21281788 |
| S | 249 | P | Prostate cancer/carcinoma/adenocarcinoma | Phosphorylation | 21969818 |
| K | 273 | U | Colon cancer | Methylation | 30535125 |
| S | 256 | U | Astrocytoma/astrocytoma glioblastoma | Phosphorylation | 23874926 |
| S | 256 | U | Breast cancer | Phosphorylation | 36797347 |
| S | 319 | U | Sjogren's syndrome | Phosphorylation | 34948236 |
| T | 24 | U | Breast cancer | Phosphorylation | 36797347 |
| T | 24 | U | Prostate cancer | Phosphorylation | 36720852 |
| S | 329 | U | B-cell acute lymphoblastic leukemia | Phosphorylation | 33393494 |
| S | 319 | U | Melanoma | Phosphorylation | 36210843 |
| S | 319 | U | Prostate cancer | Phosphorylation | 36720852 |
| - | - | U | Glioma | Ubiquitination | 33408486 |
| - | - | U | Hepatocellular carcinoma | Ubiquitination | 37099251 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
