| Id: | acc1536 |
| Group: | 2sens |
| Protein: | HSP27 |
| Gene Symbol: | HSPB1 |
| Protein Id: | P04792 |
| Protein Name: | HSPB1_HUMAN |
| PTM: | phosphorylation |
| Site: | Ser78 |
| Site Sequence: | AAPAYSRALSRQLSSGVSEIR |
| Disease Category: | Cancer |
| Disease: | Breast Cancer |
| Disease Subtype: | Ductal carcinoma |
| Disease Cellline: | JIMT-1 |
| Disease Info: | |
| Drug: | TZMB |
| Drug Info: | - |
| Effect: | inhibit |
| Effect Info: | "Combined use of TZMB and HSP27 functional inhibitor J2 significantly reduces the phosphorylation of HSP27 at S15/78, weakens HER2 and its downstream signaling, and enhances the sensitivity of TZMB-resistant cells and JIMT1 xenograft mouse models to TZMB." |
| Note: | |
| Score: | 5.0 |
| Pubmed(PMID): | 32545363 |
| Sentence Index: | 32545363_5-6 |
| Sentence: | "By extensively utilizing TZMB-refractory breast cancer cell lines transduced with diverse phosphovariants of HSP27, our study newly revealed that specific phosphorylation of HSP27 at S15 promoted its S78 phosphorylation and served as key mediator to promote direct interactions that increase the stability of HER2 and protein kinase B (AKT). This phosphorylation promoted nuclear translocation of HER2, enhancing the distinct nuclear function of HER2 that promoted AKT activation and cyclin D1 expression." |
Sequence & Structure:
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
Select PDB:
| Target | Drug name | MOA | Phase | Status | Disease | Source |
|---|---|---|---|---|---|---|
| HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 2 | Unknown status | squamous cell lung carcinoma | ClinicalTrials |
| HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 2 | Completed | pancreatic carcinoma | ClinicalTrials |
| HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 2 | Completed | non-small cell lung carcinoma | ClinicalTrials |
| HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 2 | Completed | prostate cancer | ClinicalTrials |
| HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 2 | Terminated | prostate cancer | ClinicalTrials |
| HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 1 | Completed | neoplasm | ClinicalTrials |
| HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 1 | Unknown status | urinary bladder cancer | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTAC| HSPB1-Ser78 | |
|---|---|
| Cancer | Intensity |
| BRCA | 0.707 |
| COAD | |
| HGSC | |
| ccRCC | -0.707 |
| GBM | |
| HNSC | |
| LUAD | |
| LUSC | |
| non_ccRCC | |
| PDAC | |
| UCEC | |
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| S | 78 | N | Dilated cardiomyopathy | Phosphorylation | 34477462 |
| S | 78 | P | Pancreatic cancer/carcinoma/adenocarcinoma | Phosphorylation | 22012255 |
| S | 78 | U | Breast cancer/tumor/carcinoma | Phosphorylation | 17697330 |
| S | 78 | U | Head and neck squamous cell carcinoma | Phosphorylation | 34498800 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
