Id: acc1586
Group: 2sens
Protein: Caveolin-1
Gene Symbol: CAV1
Protein Id: Q03135
Protein Name: CAV1_HUMAN
PTM: phosphorylation
Site: Tyr14
Site Sequence: KYVDSEGHLYTVPIREQGNIY
Disease Category: Cancer
Disease: Breast Cancer
Disease Subtype: adriamycin-resistant
Disease Cellline: MCF7/Adr
Disease Info:
Drug: adriamycin(Dox)
Drug Info: "Doxorubicin (Adriamycin, DOX) is a broad-spectrum anthracycline antibiotic used in the treatment of various cancers, including acute leukemia, malignant lymphoma, breast cancer, and ovarian cancer, by inhibiting DNA synthesis through intercalation and topoisomerase II interference. "
Effect: resist
Effect Info: "It was found that c-Src-dependent Caveolin-1 phosphorylation promoted the translocation of P-gp to caveolae, resulting in multidrug resistance in doxorubicin-resistant gastric cancer SGC7901/Adr and breast cancer MCF-7/Adr cells."
Note:
Score: 5.0
Pubmed(PMID): 25788263
Sentence Index:
Sentence:

Sequence & Structure:

MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets
Small molecule
Antibody
PROTAC
Other modalities
Approved Drug
Advanced Clinical
Phase 1 Clinical
Structure with Ligand
High-Quality Ligand
High-Quality Pocket
Med-Quality Pocket
Druggable Family
Approved Drug
Advanced Clinical
Phase 1 Clinical
UniProt loc high conf
GO CC high conf
UniProt loc med conf
UniProt SigP or TMHMM
GO CC med conf
Human Protein Atlas loc
Approved Drug
Advanced Clinical
Phase 1 Clinical
Literature
UniProt Ubiquitination
Database Ubiquitination
Half-life Data
Small Molecule Binder
Approved Drug
Advanced Clinical
Phase 1 Clinical

PTM Intensity:

source: CPTAC
CAV1-Tyr14
Cancer Intensity
BRCA
COAD 0.37
HGSC 0.828
ccRCC 0.274
GBM 1.665
HNSC -0.226
LUAD -1.503
LUSC -0.584
non_ccRCC
PDAC
UCEC -0.824

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
Y 14 D Breast cancer Phosphorylation 30673589
Y 14 U Breast cancer/tumor/carcinoma Phosphorylation 18922892
Y 14 U Colon cancer/carcinoma Phosphorylation 18922892

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM
Protein Gene PTM Position Modified sequence Cell Drug pEC50 Regulation Experiment
Q03135 CAV1 P Tyr14 YVDSEGHLY(ph)TVPIR A549 Dactolisib 8.5029 -
Q03135 CAV1 P Tyr14 YVDSEGHLY(ph)TVPIR PC-9 LapatinibAZD4547 5.2586 -
Q03135 CAV1 P Tyr14 YVDSEGHLY(ph)TVPIR PC-9 Lapatinib 5.351 -
Q03135 CAV1 P Tyr14 YVDSEGHLY(ph)TVPIR PC-9 AZD4547 4.7612 -
Q03135 CAV1 P Tyr14 YVDSEGHLY(ph)TVPIR PC-9 AZD4547 4.7488 -
Q03135 CAV1 P Tyr14 YVDSEGHLY(ph)TVPIR A549 Tideglusib 9.1578 -
Q03135 CAV1 P Tyr14 YVDSEGHLY(ph)TVPIR A549 Pictilisib 7.2534 -
Q03135 CAV1 P Tyr14 YVDSEGHLY(ph)TVPIR A549 Nintedanib 6.2482 -
Q03135 CAV1 P Tyr14 YVDSEGHLY(ph)TVPIR A549 Dasatinib 8.3774 -
Q03135 CAV1 P Tyr14 YVDSEGHLY(ph)TVPIR A431 Afatinib 4.2622 -
Q03135 CAV1 P Tyr14 YVDSEGHLY(ph)TVPIR A549 AZD8055 7.6648 -
Q03135 CAV1 P Tyr14 YVDSEGHLY(ph)TVPIR A431 Gefitinib 6.091 -
Q03135 CAV1 P Tyr14 YVDSEGHLY(ph)TVPIR A431 Gefitinib 4.8448 -
Q03135 CAV1 P Tyr14 YVDSEGHLY(ph)TVPIR A431 Gefitinib 9.2398 -
Q03135 CAV1 P Tyr14 YVDSEGHLY(ph)TVPIR A431 Gefitinib 6.5377 -
Q03135 CAV1 P Tyr14 YVDSEGHLY(ph)TVPIR A431 Afatinib 7.7619 -
Q03135 CAV1 P Tyr14 YVDSEGHLY(ph)TVPIR A431 Afatinib 7.7836 -
Q03135 CAV1 P Tyr14 YVDSEGHLY(ph)TVPIR A431 Afatinib 12.8809 -

pEC50 Note: pEC50 is the negative logarithm of EC50 (half-maximal effective concentration, dosage unit Mol), calculated as pEC50 = -log10(EC50), which quantifies the potency of a drug or compound.

Function score:

source: funscoR

No data.

Cross Links: