PMADS

Id:	acc1735
Group:	2sens
Protein:	BAD
Gene Symbol:	BAD
Protein Id:	P50408
Protein Name:	VATF_RAT
PTM:	phosphorylation
Site:	Ser136
Site Sequence:	----------------------------
Disease Category:	Cancer
Disease:	Osteosarcoma
Disease Subtype:
Disease Cellline:
Disease Info:
Drug:	quercetin(QUE)
Drug Info:	"Quercetin (QUE) is a naturally occurring flavonoid with antioxidant, anti-inflammatory, and potential anticancer properties, commonly found in various fruits, vegetables, and grains, and used as a dietary supplement for its purported health benefits."
Effect:	modulate
Effect Info:	"100 μM quercetin decreased the phosphorylation levels of AKT and BAD and increased the phosphorylation of ERK1/2, leading to the death of osteosarcoma cells."
Note:
Score:	4.0
Pubmed(PMID):	35447220
Sentence Index:	35447220_10-11
Sentence:	"In addition, the ERK1/2 phosphorylation increased leading to osteosarcoma cell death since pre-treatment with the MEK inhibitor PD98059 had reverted QUE effect. Altogether, these results indicate that low concentrations of QUE stimulate osteoblastogenesis but have no effect on the growth of tumor osteoblast cells, for which only high concentrations are efficient."

Sequence & Structure:

MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRAKGMFTAEDLR

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No intensity data of this site,
show all other sites!

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: