Id: | acc1743 |
Group: | 2sens_supp |
Protein: | ERK2 |
Gene Symbol: | MAPK1 |
Protein Id: | P28482 |
Protein Name: | MK01_HUMAN |
PTM: | phosphorylation |
Site: | Tyr187? |
Site Sequence: | HDHTGFLTEYVATRWYRAPEI |
Disease Category: | Cancer |
Disease: | Breast Cancer |
Disease Subtype: | |
Disease Cellline: | MCF7 |
Disease Info: | |
Drug: | U0126 |
Drug Info: | "U0126 is a selective MEK inhibitor that effectively inhibits ERK1/2 phosphorylation with IC50 values of 72 nM and 58 nM, demonstrating significantly higher inhibitory activity compared to PD98059." |
Effect: | inhibit |
Effect Info: | Fibroblast growth factor 1 (FGF-1) and human heregulin beta 1 (HRGbeta1) can trigger sustained ERK1/2 activation and resist the effect of the MEK inhibitor U0126. |
Note: | |
Score: | 5.0 |
Pubmed(PMID): | 15231676 |
Sentence Index: | 15231676_10-11 |
Sentence: | "We found that either FGF-1 or HRGbeta1 but not EGF substantially reduced the inhibitory effects of U0126 on growth and ERK1/2 activation, including the combined inhibitory effects of U0126 and ICI 182780. Phosphorylation of ERK5 by all three of the factors was also resistant to U0126 suggesting that its activation is not sufficient to overturn growth inhibition due to diminished ERK1/2 activation. Therefore, therapy combining antiestrogens and MEK inhibitors may be ineffective in some antiestrogen-resistant estrogen receptor-positive breast cancers." |
Sequence & Structure:
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Terminated | neoplasm | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 2 | Completed | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Recruiting | histiocytic neoplasm | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Active, not recruiting | Uveal Melanoma | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 2 | Terminated | cancer | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | acute myeloid leukemia | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | myelodysplastic syndrome | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 1 | Recruiting | acute myeloid leukemia | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials |
MAPK1 | RAVOXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Terminated | neoplasm | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Recruiting | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Terminated | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Recruiting | metastatic colorectal cancer | ClinicalTrials |
MAPK1 | KO-947 | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 1 | Terminated | cancer | ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Completed | colorectal cancer | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 0.5 | Recruiting | glioblastoma multiforme | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 0.5 | Recruiting | Paraganglioma | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo intensity data of this site,
show all other sites!
MAPK1-Thr181 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | -0.957 | ||||
GBM | 0.466 | ||||
HNSC | 1.279 | ||||
LUAD | 0.285 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -1.072 |
MAPK1-Thr185 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 2.529 | ||||
COAD | -0.118 | ||||
HGSC | -0.164 | ||||
ccRCC | -0.105 | ||||
GBM | -0.046 | ||||
HNSC | -0.09 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | -0.821 | ||||
PDAC | -0.882 | ||||
UCEC | -0.302 |
MAPK1-Tyr187 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.772 | ||||
COAD | 0.273 | ||||
HGSC | 0.701 | ||||
ccRCC | -0.806 | ||||
GBM | 0.279 | ||||
HNSC | 0.328 | ||||
LUAD | 0.387 | ||||
LUSC | 0.866 | ||||
non_ccRCC | -2.593 | ||||
PDAC | 0.32 | ||||
UCEC | -0.527 |
MAPK10-Thr221 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | 0.707 | ||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -0.707 |
MAPK10-Tyr223 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | -0.707 | ||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.707 |
MAPK13-Ser350 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.145 | ||||
COAD | 0.5 | ||||
HGSC | 1.029 | ||||
ccRCC | -1.866 | ||||
GBM | |||||
HNSC | 0.744 | ||||
LUAD | -0.887 | ||||
LUSC | -0.463 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.797 |
MAPK13-Thr180 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | -0.286 | ||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | 0.146 | ||||
LUAD | |||||
LUSC | 0.689 | ||||
non_ccRCC | -1.554 | ||||
PDAC | |||||
UCEC | 1.005 |
MAPK13-Thr265 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | 0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -0.707 |
MAPK13-Tyr182 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.573 | ||||
COAD | -1.084 | ||||
HGSC | 1.31 | ||||
ccRCC | |||||
GBM | |||||
HNSC | 0.115 | ||||
LUAD | 0.311 | ||||
LUSC | -0.255 | ||||
non_ccRCC | -1.737 | ||||
PDAC | |||||
UCEC | 0.767 |
MAPK14-Ser143 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | 0.707 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -0.707 |
MAPK14-Ser252 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.822 | ||||
COAD | |||||
HGSC | 2.685 | ||||
ccRCC | -0.234 | ||||
GBM | -0.193 | ||||
HNSC | 0.262 | ||||
LUAD | -0.258 | ||||
LUSC | -0.426 | ||||
non_ccRCC | 0.143 | ||||
PDAC | -0.484 | ||||
UCEC | -0.672 |
MAPK14-Ser32 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | -0.707 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.707 |
MAPK14-Thr175 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | 0.659 | ||||
GBM | |||||
HNSC | -1.151 | ||||
LUAD | 0.492 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
MAPK14-Thr180 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 2.28 | ||||
COAD | 0.452 | ||||
HGSC | -1.055 | ||||
ccRCC | -0.189 | ||||
GBM | -0.187 | ||||
HNSC | 0.188 | ||||
LUAD | 0.929 | ||||
LUSC | 0.063 | ||||
non_ccRCC | -0.898 | ||||
PDAC | -0.317 | ||||
UCEC | -1.265 |
MAPK14-Thr185 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.707 | ||||
HGSC | -0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
MAPK14-Thr239 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | -0.707 | ||||
GBM | |||||
HNSC | 0.707 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
MAPK14-Thr241 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | 1.02 | ||||
ccRCC | -0.978 | ||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | -0.042 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
MAPK14-Tyr182 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 2.374 | ||||
COAD | -0.005 | ||||
HGSC | -0.861 | ||||
ccRCC | 0.066 | ||||
GBM | 1.175 | ||||
HNSC | -0.22 | ||||
LUAD | 0.029 | ||||
LUSC | -0.105 | ||||
non_ccRCC | -0.927 | ||||
PDAC | -0.488 | ||||
UCEC | -1.039 |
MAPK15-Ser415 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | -1.152 | ||||
LUSC | 0.644 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.508 |
MAPK15-Thr97 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | -0.697 | ||||
LUSC | -0.449 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 1.146 |
MAPK1IP1L-Ser15 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | 0.707 |
ccRCC | |
GBM | |
HNSC | -0.707 |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
Y | 187 | U | Thyroid cancer/carcinoma | Phosphorylation | 17209045 |
Y | 187 | U | Triple-negative breast cancer | Phosphorylation | 28415597 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.