PMADS

Id:	acc1753
Group:	2sens
Protein:	Bad
Gene Symbol:	BAD
Protein Id:	P50408
Protein Name:	VATF_RAT
PTM:	phosphorylation
Site:	Ser75
Site Sequence:	INQYIAEMVRHALDAHQRSIP
Disease Category:	Cancer
Disease:	Melanoma
Disease Subtype:
Disease Cellline:	A2058
Disease Info:
Drug:	BAY 43-9006(sorafenib)
Drug Info:	"Sorafenib (BAY 43-9006) is an orally active multi-kinase inhibitor targeting Raf-1 (IC50 = 6 nM), B-Raf (IC50 = 20 nM), VEGFR2 (IC50 = 90 nM), VEGFR3 (IC50 = 15 nM), PDGFRbeta (IC50 = 20 nM), FLT3 (IC50 = 57 nM), and c-Kit (IC50 = 58 nM), with demonstrated antitumor activity through induction of apoptosis, autophagy, and ferroptosis."
Effect:	modulate
Effect Info:	"BAY 43 - 9006 (sorafenib) induces apoptosis in A2058 and SKMEL5 melanoma cells through a caspase - independent mechanism, which involves the dephosphorylation of Bad and the activation of Bak and Bax."
Note:
Score:	4.0
Pubmed(PMID):	16452220
Sentence Index:	16452220_3-4
Sentence:	"At concentrations that suppress extracellular signal-regulated kinase (ERK) phosphorylation, BAY 43-9006 dephosphorylates Bad on Ser(75) and Ser(99), activates Bak and Bax, and reduces the mitochondrial transmembrane potential. BAY 43-9006 (sorafenib) down-modulates the levels of Bcl-2 and Bcl-X(L) in a MAPK-independent manner in A2058 and SKMEL5 melanoma cells but not in the more resistant A375 cells."

Sequence & Structure:

MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRAKGMFTAEDLR

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: