| Id: | acc1754 |
| Group: | 2sens |
| Protein: | Bad |
| Gene Symbol: | BAD |
| Protein Id: | P50408 |
| Protein Name: | VATF_RAT |
| PTM: | phosphorylation |
| Site: | Ser99 |
| Site Sequence: | EIPSKEHPYDAAKDSILRRAK |
| Disease Category: | Cancer |
| Disease: | Melanoma |
| Disease Subtype: | |
| Disease Cellline: | A2058 |
| Disease Info: | |
| Drug: | BAY 43-9006(sorafenib) |
| Drug Info: | "Sorafenib (BAY 43-9006) is an orally active multi-kinase inhibitor targeting Raf-1 (IC50 = 6 nM), B-Raf (IC50 = 20 nM), VEGFR2 (IC50 = 90 nM), VEGFR3 (IC50 = 15 nM), PDGFRbeta (IC50 = 20 nM), FLT3 (IC50 = 57 nM), and c-Kit (IC50 = 58 nM), with demonstrated antitumor activity through induction of apoptosis, autophagy, and ferroptosis." |
| Effect: | modulate |
| Effect Info: | "BAY 43 - 9006 (sorafenib) induces apoptosis in A2058 and SKMEL5 melanoma cells through a caspase - independent mechanism, which includes the dephosphorylation of Bad and the activation of Bak and Bax." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 16452220 |
| Sentence Index: | 16452220_3-4 |
| Sentence: | "At concentrations that suppress extracellular signal-regulated kinase (ERK) phosphorylation, BAY 43-9006 dephosphorylates Bad on Ser(75) and Ser(99), activates Bak and Bax, and reduces the mitochondrial transmembrane potential. BAY 43-9006 (sorafenib) down-modulates the levels of Bcl-2 and Bcl-X(L) in a MAPK-independent manner in A2058 and SKMEL5 melanoma cells but not in the more resistant A375 cells." |
Sequence & Structure:
MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRAKGMFTAEDLR
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTAC| BAD-Ser99 | |
|---|---|
| Cancer | Intensity |
| BRCA | 0.402 |
| COAD | -1.167 |
| HGSC | 1.633 |
| ccRCC | -1.772 |
| GBM | -0.506 |
| HNSC | -0.659 |
| LUAD | -0.029 |
| LUSC | 0.613 |
| non_ccRCC | 0.977 |
| PDAC | -0.255 |
| UCEC | 0.764 |
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
