| Id: | acc1807 |
| Group: | 2sens |
| Protein: | MtCK1 |
| Gene Symbol: | CKMT2 |
| Protein Id: | P17540 |
| Protein Name: | KCRS_HUMAN |
| PTM: | phosphorylation |
| Site: | Tyr153 |
| Site Sequence: | DLDASKITQGQFDEHYVLSSR |
| Disease Category: | Cancer |
| Disease: | Breast Cancer |
| Disease Subtype: | "Ductal Carcinoma, HER2+" |
| Disease Cellline: | BT474(trastuzumab-resistant) |
| Disease Info: | |
| Drug: | lapatinib |
| Drug Info: | "Lapatinib is a targeted therapy drug used in combination with capecitabine for the treatment of HER2-overexpressing advanced or metastatic breast cancer in patients who have received prior anthracycline, taxane, and trastuzumab-based therapies." |
| Effect: | inhibit |
| Effect Info: | A decrease in MtCK1 phosphorylation promotes the efficacy of drug treatment. |
| Note: | |
| Score: | 5.0 |
| Pubmed(PMID): | 30174304 |
| Sentence Index: | 30174304_2-3 |
| Sentence: | "Here, we show that oncogenic HER2 tyrosine kinase signaling induces phosphorylation of mitochondrial creatine kinase 1 (MtCK1) on tyrosine 153 (Y153) in an ABL-dependent manner in breast cancer cells. Y153 phosphorylation, which is commonly upregulated in HER2+ breast cancers, stabilizes MtCK1 to increase the phosphocreatine energy shuttle and promote proliferation." |
Sequence & Structure:
MASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo intensity data of this site,
show all other sites!
| CKMT2-Ser233 | |
|---|---|
| Cancer | Intensity |
| BRCA | |
| COAD | |
| HGSC | |
| ccRCC | 0.56 |
| GBM | |
| HNSC | -1.155 |
| LUAD | |
| LUSC | |
| non_ccRCC | 0.595 |
| PDAC | |
| UCEC | |
| CKMT2-Ser319 | |
|---|---|
| Cancer | Intensity |
| BRCA | |
| COAD | |
| HGSC | |
| ccRCC | 0.354 |
| GBM | |
| HNSC | -1.129 |
| LUAD | |
| LUSC | |
| non_ccRCC | 0.775 |
| PDAC | |
| UCEC | |
| CKMT2-Thr316 | |
|---|---|
| Cancer | Intensity |
| BRCA | |
| COAD | |
| HGSC | |
| ccRCC | 0.707 |
| GBM | |
| HNSC | -0.707 |
| LUAD | |
| LUSC | |
| non_ccRCC | |
| PDAC | |
| UCEC | |
| CKMT2-Thr356 | |
|---|---|
| Cancer | Intensity |
| BRCA | |
| COAD | |
| HGSC | |
| ccRCC | |
| GBM | |
| HNSC | -0.707 |
| LUAD | |
| LUSC | |
| non_ccRCC | 0.707 |
| PDAC | |
| UCEC | |
| CKMT2-Tyr368 | |
|---|---|
| Cancer | Intensity |
| BRCA | |
| COAD | |
| HGSC | |
| ccRCC | |
| GBM | |
| HNSC | -0.707 |
| LUAD | |
| LUSC | |
| non_ccRCC | 0.707 |
| PDAC | |
| UCEC | |
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
