| Id: | acc1825 |
| Group: | 2sens |
| Protein: | histone H3 |
| Gene Symbol: | H3C1 |
| Protein Id: | P68431 |
| Protein Name: | H31_HUMAN |
| PTM: | methylation |
| Site: | Lys27 |
| Site Sequence: | RKQLATKAARKSAPATGGVKK |
| Disease Category: | Cancer |
| Disease: | Leukemia |
| Disease Subtype: | |
| Disease Cellline: | HL-60 |
| Disease Info: | |
| Drug: | ATRA |
| Drug Info: | "ATRA (All-trans retinoic acid) is a vitamin A derivative used topically for treating acne vulgaris, psoriasis, and other dermatological conditions, and orally as a primary treatment for acute promyelocytic leukemia (APL) in combination regimens. " |
| Effect: | modulate |
| Effect Info: | "Treatment with ATRA reduces H3 methylation and increases H4 acetylation, and enhances the expression of CD11B." |
| Note: | histone |
| Score: | 3.0 |
| Pubmed(PMID): | 19578722 |
| Sentence Index: | 19578722_2-3 |
| Sentence: | "Here, we try to reveal how PRC2, PRC2-mediated repressive histone marker H3K27me3, and active histone marker histone H4 acetylation (acH4) regulate the CD11b transcription during alltrans retinoic acid (ATRA)-induced HL-60 leukemia cell differentiation. By using quantitative real-time polymerase chain reaction (qPCR) and western blot analysis, we found that the mRNA and protein expression levels of two members of PRC2 were decreased during ATRA-induced HL-60 differentiation, respectively." |
Sequence & Structure:
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| K | 27 | A | Oligodendroglioma | Methylation | 34020723 |
| K | 27 | D | Cervical intraepithelial neoplasia | Acetylation | 28716899 |
| K | 27 | D | Acute myelogenous leukemia | Methylation | 22897849 |
| K | 27 | D | Autism spectrum disorder | Methylation | 23423141 |
| K | 27 | D | Malignant peripheral nerve sheath tumor | Methylation | 28752843 |
| K | 27 | D | Ovarian cancer | Methylation | 20053926 |
| K | 27 | D | Systemic lupus erythematosus | Methylation | 36165173 |
| K | 27 | U | Anaplastic large cell lymphoma | Acetylation | 22899583 |
| K | 27 | U | Melanoma | Acetylation | 32079144 |
| K | 27 | U | Merkel cell carcinoma | Acetylation | 25941994 |
| K | 27 | U | Fragile X syndrome | Methylation | 18628788 |
| K | 27 | U | Follicular lymphoma | Methylation | 35661922 |
| K | 27 | U | Pediatric-type follicular lymphoma | Methylation | 35661922 |
| K | 27 | U | Primary cutaneous follicle center cell lymphoma | Methylation | 35661922 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
