Id: acc1854
Group: 2sens
Protein: histone H3
Gene Symbol: H3C1
Protein Id: P68431
Protein Name: H31_HUMAN
PTM: methylation
Site: Lys9
Site Sequence: -MARTKQTARKSTGGKAPRKQ
Disease Category: Cancer
Disease: Colorectal Cancer
Disease Subtype:
Disease Cellline: SW480
Disease Info:
Drug: Mithramycin
Drug Info: "Mithramycin (MTM) is an antineoplastic antibiotic historically used in the treatment of testicular embryonal cell carcinoma and renal cell carcinoma, though its clinical use has been limited due to significant toxicity and the availability of safer alternatives."
Effect: modulate
Effect Info: "The expression of SETDB1 and H3K9me3 was downregulated in cells treated with mitomycin, significantly inhibiting the cell viability of SW48 and LoVo cell lines in a dose - and time - dependent manner."
Note: histone
Score: 3.0
Pubmed(PMID): 32473242
Sentence Index:
Sentence:

Sequence & Structure:

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
K 9 D Diabetes mellitus Acetylation 23423566
K 9 D Friedreich's ataxia Acetylation 18045775
K 9 D Prostate cancer Acetylation 19885564
K 9 D Systemic lupus erythematosus Acetylation 36165173
K 9 D Prostate cancer Methylation 19739128
K 9 D Pancreatic carcinoma Methylation 20142597
K 9 U Prostate cancer Acetylation 19935671
K 9 U Diabetes mellitus Acetylation 23423566
K 9 U Gastric adenocarcinoma Acetylation 18470569
K 9 U Type 2 diabetes Acetylation 34944721
K 9 U Breast cancer Methylation 19943104
K 9 U Friedreich's ataxia Methylation 18045775
K 9 U Friedreich's ataxia Methylation 18045775

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: