| Id: | acc1855 |
| Group: | 2sens |
| Protein: | histone H3 |
| Gene Symbol: | H3C1 |
| Protein Id: | P68431 |
| Protein Name: | H31_HUMAN |
| PTM: | methylation |
| Site: | Lys9 |
| Site Sequence: | -MARTKQTARKSTGGKAPRKQ |
| Disease Category: | Cancer |
| Disease: | Colorectal Cancer |
| Disease Subtype: | |
| Disease Cellline: | LoVo |
| Disease Info: | |
| Drug: | Mithramycin |
| Drug Info: | "Mithramycin (MTM) is an antineoplastic antibiotic historically used in the treatment of testicular embryonal cell carcinoma and renal cell carcinoma, though its clinical use has been limited due to significant toxicity and the availability of safer alternatives." |
| Effect: | modulate |
| Effect Info: | "The expression of SETDB1 and H3K9me3 was downregulated in cells treated with mitomycin, significantly inhibiting the cell viability of SW48 and LoVo cell lines in a dose- and time-dependent manner." |
| Note: | histone |
| Score: | 3.0 |
| Pubmed(PMID): | 32473242 |
| Sentence Index: | 32473242_0-1 |
| Sentence: | "Blocking histone methyltransferase SETDB1 inhibits tumorigenesis and enhances cetuximab sensitivity in colorectal cancer. The histone methyltransferase SETDB1 catalyzes the addition of methyl groups to histone H3 at lysine 9, and upregulation of SETDB1 is associated with poor prognosis in cancer patients." |
Sequence & Structure:
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| K | 9 | D | Diabetes mellitus | Acetylation | 23423566 |
| K | 9 | D | Friedreich's ataxia | Acetylation | 18045775 |
| K | 9 | D | Prostate cancer | Acetylation | 19885564 |
| K | 9 | D | Systemic lupus erythematosus | Acetylation | 36165173 |
| K | 9 | D | Prostate cancer | Methylation | 19739128 |
| K | 9 | D | Pancreatic carcinoma | Methylation | 20142597 |
| K | 9 | U | Prostate cancer | Acetylation | 19935671 |
| K | 9 | U | Diabetes mellitus | Acetylation | 23423566 |
| K | 9 | U | Gastric adenocarcinoma | Acetylation | 18470569 |
| K | 9 | U | Type 2 diabetes | Acetylation | 34944721 |
| K | 9 | U | Breast cancer | Methylation | 19943104 |
| K | 9 | U | Friedreich's ataxia | Methylation | 18045775 |
| K | 9 | U | Friedreich's ataxia | Methylation | 18045775 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
