Id: | acc2021 |
Group: | 2sens |
Protein: | BIM |
Gene Symbol: | BCL2L11 |
Protein Id: | P55916 |
Protein Name: | UCP3_HUMAN |
PTM: | phosphorylation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Cancer |
Disease: | Leukemia |
Disease Subtype: | TALL |
Disease Cellline: | SUPT-1 |
Disease Info: | |
Drug: | prednisolone |
Drug Info: | "Prednisolone is a synthetic glucocorticoid with anti-inflammatory and immunosuppressive properties, used to treat inflammatory and immune-mediated conditions such as rheumatoid arthritis, severe allergies, and autoimmune disorders." |
Effect: | inhibit |
Effect Info: | MAPK-ERK signaling causes steroid resistance through BIM phosphorylation. Treatment with a MEK inhibitor eliminates this inactivating phosphorylation of BIM. |
Note: | site unclear |
Score: | 5.0 |
Pubmed(PMID): | 34007050 |
Sentence Index: | 34007050_4-5 |
Sentence: | "Treatment with MEK inhibitors abolishes this inactivating phosphorylation of BIM and restores its interaction with anti-apoptotic BCL2-protein family members. Importantly, the MEK inhibitor selumetinib synergizes with steroids in both IL7-dependent and IL7-independent steroid resistant pediatric T-ALL PDX samples." |
Sequence & Structure:
MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRGVLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTRILAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRALMKVQMLRESPF
No data.
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo intensity data of this site,
show all other sites!
BCL2L11-Ser104 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | 0.707 |
ccRCC | |
GBM | |
HNSC | |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC | -0.707 |
BCL2L11-Ser118 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | 0.707 |
ccRCC | |
GBM | |
HNSC | -0.707 |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
BCL2L11-Ser77 | |
---|---|
Cancer | Intensity |
BRCA | -1.869 |
COAD | |
HGSC | 1.655 |
ccRCC | 0.169 |
GBM | |
HNSC | 0.422 |
LUAD | 0.134 |
LUSC | -0.138 |
non_ccRCC | 0.29 |
PDAC | |
UCEC | -0.663 |
BCL2L11-Ser92 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | |
GBM | |
HNSC | -0.707 |
LUAD | 0.707 |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
BCL2L11-Ser93 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | |
GBM | |
HNSC | -0.707 |
LUAD | 0.707 |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
BCL2L11-Ser94 | |
---|---|
Cancer | Intensity |
BRCA | -1.664 |
COAD | |
HGSC | 1.002 |
ccRCC | -0.246 |
GBM | |
HNSC | -0.477 |
LUAD | 0.629 |
LUSC | -0.105 |
non_ccRCC | 1.47 |
PDAC | |
UCEC | -0.61 |
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.