| Id: | acc2124 |
| Group: | 2sens |
| Protein: | p36 |
| Gene Symbol: | Nt5c3a |
| Protein Id: | Q9D020 |
| Protein Name: | 5NT3A_MOUSE |
| PTM: | phosphorylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Cancer |
| Disease: | Lung Cancer |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Butylated hydroxytoluene (BHT) |
| Drug Info: | "Butylated hydroxytoluene (BHT) is a synthetic antioxidant primarily used in food, cosmetics, and industrial products to prevent oxidative degradation of fats, oils, and polymers, and it also exhibits inhibitory activity against ferroptosis." |
| Effect: | inhibit |
| Effect Info: | "The phosphorylation level of p36 decreased after drug treatment, and the phosphorylation level of p36 was negatively correlated with the degree of pulmonary cell proliferation." |
| Note: | site unclear |
| Score: | 5.0 |
| Pubmed(PMID): | 4053047 |
| Sentence Index: | 4053047_15-16 |
| Sentence: | P36 phosphorylation also decreased when mice were given multiple BHT injections over a period of 5 weeks. These results are consistent with a hypothesis that decreased Pk-C-dependent phosphorylation of p36 is involved in lung tumor modulation by BHT. |
Sequence & Structure:
MDRAAVARVGAVASASVCAVVAGVVLAQYIFTLKRKTGRKTKIIEMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
