Id: | acc2133 |
Group: | 2sens |
Protein: | p38 |
Gene Symbol: | MAPK14 |
Protein Id: | Q16539 |
Protein Name: | MK14_HUMAN |
PTM: | phosphorylation |
Site: | Thr180 |
Site Sequence: | LARHTDDEMTGYVATRWYRAP |
Disease Category: | Cancer |
Disease: | Colorectal Cancer |
Disease Subtype: | |
Disease Cellline: | RKO |
Disease Info: | |
Drug: | melatonin |
Drug Info: | "Melatonin is a hormone that regulates circadian rhythms and supports sleep initiation and quality, commonly used as a dietary supplement for sleep-related issues. " |
Effect: | modulate |
Effect Info: | "When cells are treated with melatonin, the phosphorylation level of p38 decreases. Melatonin can down - regulate the expression of ROCK through the p38/neutrophil - activating protein kinase signaling pathway, thereby inhibiting the migration of RKO colon cancer cells. " |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 29152648 |
Sentence Index: | 29152648_11-12 |
Sentence: | "In addition, the phosphorylation levels of p38 were reduced when the cells were treated with melatonin, and treatment with H-1152 downregulated p38 phosphorylation. The results indicated that melatonin may inhibit the migration of RKO colon cancer cells by downregulating ROCK expression via the p38/mitogen-activated protein kinase signaling pathway." |
Sequence & Structure:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
MAPK14 | ARRY-797 | MAP kinase p38 alpha inhibitor | 3 | Terminated | dilated cardiomyopathy | ClinicalTrials |
MAPK14 | LOSMAPIMOD | MAP kinase p38 alpha inhibitor | 3 | Completed | acute coronary syndrome | ClinicalTrials |
MAPK14 | LOSMAPIMOD | MAP kinase p38 alpha inhibitor | 3 | Terminated | COVID-19 | ClinicalTrials |
MAPK14 | LOSMAPIMOD | MAP kinase p38 alpha inhibitor | 3 | Active, not recruiting | Facioscapulohumeral dystrophy | ClinicalTrials |
MAPK14 | ACUMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials ClinicalTrials |
MAPK14 | SEMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | Crohn's disease | ClinicalTrials ClinicalTrials ClinicalTrials |
MAPK14 | PF-03715455 | MAP kinase p38 alpha inhibitor | 2 | Terminated | chronic obstructive pulmonary disease | ClinicalTrials |
MAPK14 | DILMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials |
MAPK14 | AZD-7624 | MAP kinase p38 alpha inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials |
MAPK14 | SEMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Terminated | Crohn's disease | ClinicalTrials |
MAPK14 | PH-797804 | MAP kinase p38 alpha inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials ClinicalTrials ClinicalTrials |
MAPK14 | LOSMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
MAPK14 | ARRY-797 | MAP kinase p38 alpha inhibitor | 2 | Completed | dilated cardiomyopathy | ClinicalTrials ClinicalTrials |
MAPK14 | DORAMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Terminated | rheumatoid arthritis | ClinicalTrials |
MAPK14 | LOSMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials ClinicalTrials |
MAPK14 | BMS-582949 | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials |
MAPK14 | DORAMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | psoriasis | ClinicalTrials |
MAPK14 | BMS-582949 | MAP kinase p38 alpha inhibitor | 2 | Completed | psoriasis | ClinicalTrials |
MAPK14 | DILMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials ClinicalTrials |
MAPK14 | PG-760564 | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials |
MAPK14 | TAK-715 | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials |
MAPK14 | TALMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials ClinicalTrials |
MAPK14 | PH-797804 | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials ClinicalTrials |
MAPK14 | VX-702 | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials ClinicalTrials |
MAPK14 | DILMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | coronary artery disease | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACMAPK14-Thr180 | |
---|---|
Cancer | Intensity |
BRCA | 2.28 |
COAD | 0.452 |
HGSC | -1.055 |
ccRCC | -0.189 |
GBM | -0.187 |
HNSC | 0.188 |
LUAD | 0.929 |
LUSC | 0.063 |
non_ccRCC | -0.898 |
PDAC | -0.317 |
UCEC | -1.265 |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
T | 180 | P | Lung cancer/carcinoma | Phosphorylation | 22348039 |
T | 180 | U | Bladder cancer | Phosphorylation | 33204153 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.