Id: | acc2206 |
Group: | 2sens |
Protein: | ERK2 |
Gene Symbol: | MAPK1 |
Protein Id: | P28482 |
Protein Name: | MK01_HUMAN |
PTM: | phosphorylation |
Site: | Thr185 |
Site Sequence: | PDHDHTGFLTEYVATRWYRAP |
Disease Category: | Cancer |
Disease: | Breast Cancer |
Disease Subtype: | |
Disease Cellline: | MCF7 |
Disease Info: | |
Drug: | VPA |
Drug Info: | "VPA (Valproic acid/Sodium valproate): A broad-spectrum antiepileptic drug effective in preventing and treating various types of epileptic seizures, particularly generalized tonic-clonic seizures and absence seizures, while also exhibiting mood-stabilizing properties. " |
Effect: | modulate |
Effect Info: | "The effect of VPA in inhibiting the Warburg effect is to inactivate the phosphorylation of ERK1/2 by reducing the expression of HDAC1, thereby inhibiting the growth of breast cancer." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 34263655 |
Sentence Index: | 34263655_4-5 |
Sentence: | "In this study, we highlight that VPA significantly attenuates the Warburg effect by decreasing the expression of pyruvate kinase M2 isoform (PKM2), leading to inhibited cell proliferation and reduced colony formation in breast cancer MCF-7 and MDA-MB-231 cells. Mechanistically, Warburg effect suppression triggered by VPA was mediated by inactivation of ERK1/2 phosphorylation through reduced HDAC1 expression, resulting in suppressing breast cancer growth." |
Sequence & Structure:
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Terminated | neoplasm | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 2 | Completed | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Recruiting | histiocytic neoplasm | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Active, not recruiting | Uveal Melanoma | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 2 | Terminated | cancer | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | acute myeloid leukemia | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | myelodysplastic syndrome | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 1 | Recruiting | acute myeloid leukemia | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials |
MAPK1 | RAVOXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Terminated | neoplasm | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Recruiting | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Terminated | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Recruiting | metastatic colorectal cancer | ClinicalTrials |
MAPK1 | KO-947 | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 1 | Terminated | cancer | ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Completed | colorectal cancer | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 0.5 | Recruiting | glioblastoma multiforme | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 0.5 | Recruiting | Paraganglioma | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACMAPK1-Thr185 | |
---|---|
Cancer | Intensity |
BRCA | 2.529 |
COAD | -0.118 |
HGSC | -0.164 |
ccRCC | -0.105 |
GBM | -0.046 |
HNSC | -0.09 |
LUAD | |
LUSC | |
non_ccRCC | -0.821 |
PDAC | -0.882 |
UCEC | -0.302 |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | A | Colon cancer/carcinoma | Phosphorylation | 23786838 |
- | - | D | Colorectal cancer | Phosphorylation | 36526622 |
- | - | D | Squamous cell carcinoma of the larynx | Phosphorylation | 16865246 |
- | - | D | Pulmonary carcinoid | Phosphorylation | 15956248 |
- | - | D | Myelodysplasia | Phosphorylation | 12529294 |
- | - | P | Bladder cancer | Phosphorylation | 24375195 |
- | - | P | Non-small cell lung cancer/carcinoma | Phosphorylation | 24096476 |
- | - | P | Acute myeloid leukemia/acute myelogenous leukemia | Phosphorylation | 23840454 |
- | - | P | Liver cancer | Phosphorylation | 23693078 |
- | - | P | Colon cancer/carcinoma | Phosphorylation | 23183114 |
- | - | P | Thyroid cancer/carcinoma | Phosphorylation | 11299771 |
- | - | P | Astrocytoma/astrocytoma glioblastoma | Phosphorylation | 17327470 |
- | - | P | Rhabdomyosarcoma | Phosphorylation | 14633723 |
- | - | P | Brain cancer | Phosphorylation | 12388552 |
- | - | U | Lung cancer/carcinoma | Phosphorylation | 24286320 |
- | - | U | Bipolar disorder | Phosphorylation | 24075327 |
- | - | U | Glioblastoma | Phosphorylation | 36493392 |
- | - | U | Crohn's disease | Phosphorylation | 23970928 |
- | - | U | Neuroblastoma | Phosphorylation | 15972965 |
- | - | U | Adenoma | Phosphorylation | 21989899 |
- | - | U | Breast cancer/tumor/carcinoma | Phosphorylation | 10216485 |
- | - | U | Prostate cancer/carcinoma/adenocarcinoma | Phosphorylation | 9927031 |
- | - | U | Glioblastoma | Phosphorylation | 23115159 |
- | - | U | Pancreatic cancer | Phosphorylation | 21678462 |
- | - | U | Clear cell renal cell carcinoma | Phosphorylation | 36966163 |
- | - | U | Lymphoma | Phosphorylation | 23620775 |
S | 41 | U | Choriocarcinoma | Phosphorylation | 11466319 |
- | - | U | Clear cell renal cell carcinoma | Phosphorylation | 37454877 |
- | - | U | Osteosarcoma | Phosphorylation | 31383289 |
- | - | U | Ovarian cancer/carcinoma | Phosphorylation | 23285101 |
Y | 204 | U | Pulmonary emphysema | Phosphorylation | 14764579 |
Y | 187 | U | Triple-negative breast cancer | Phosphorylation | 28415597 |
Y | 187 | U | Thyroid cancer/carcinoma | Phosphorylation | 17209045 |
Y | 204 | U | Hepatocellular carcinoma | Phosphorylation | 36230524 |
T | 202 | U | Pulmonary emphysema | Phosphorylation | 14764579 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMProtein | Gene | PTM | Position | Modified sequence | Cell | Drug | pEC50 | Regulation | Experiment |
---|---|---|---|---|---|---|---|---|---|
P28482 | MAPK1 | P | Thr185 | VADPDHDHTGFLT(ph)EYVATR | BT-474 | Lapatinib | 6.6659 | down | |
P28482 | MAPK1 | P | Thr185 | VADPDHDHTGFLT(ph)EYVATR | KYSE-520 | SHP099 | 6.0769 | down | |
P28482 | MAPK1 | P | Thr185 | VADPDHDHTGFLT(ph)EYVATR | MDA-MB-175 | Lapatinib | 7.3575 | down | |
P28482 | MAPK1 | P | Thr185 | VADPDHDHTGFLT(ph)EYVATR | K562 | Imatinib | 7.1978 | - | |
P28482 | MAPK1 | P | Thr185 | VADPDHDHTGFLT(ph)EYVATR | MDA-MB-175 | Trastuzumab | 5 | - | |
P28482 | MAPK1 | P | Thr185;Tyr187 | VADPDHDHTGFLT(ph)EY(ph)VATR | MDA-MB-175 | Trastuzumab | -1.6811 | - | |
P28482 | MAPK1 | P | Thr185;Tyr187 | VADPDHDHTGFLT(ph)EY(ph)VATR | PC-9 | AZD4547 | 7.2923 | - | |
P28482 | MAPK1 | P | Thr185 | VADPDHDHTGFLT(ph)EYVATR | SK-BR-3 | Lapatinib | 4.7264 | - | |
P28482 | MAPK1 | P | Thr185 | VADPDHDHTGFLT(ph)EYVATR | SK-BR-3 | Pertuzumab | -1.769 | - | |
P28482 | MAPK1 | P | Thr185 | VADPDHDHTGFLT(ph)EYVATR | SK-BR-3 | Trastuzumab | -0.9986 | - | |
P28482 | MAPK1 | P | Thr185;Tyr187 | VADPDHDHTGFLT(ph)EY(ph)VATR | SK-BR-3 | Trastuzumab | -1.2287 | - |
pEC50 Note: pEC50 is the negative logarithm of EC50 (half-maximal effective concentration, dosage unit Mol), calculated as pEC50 = -log10(EC50), which quantifies the potency of a drug or compound.
Function score:
source: funscoRNo data.