Id: | acc2219 |
Group: | 2sens |
Protein: | GSK3beta |
Gene Symbol: | GSK3B |
Protein Id: | P49841 |
Protein Name: | GSK3B_HUMAN |
PTM: | phosphorylation |
Site: | Ser9 |
Site Sequence: | -MSGRPRTTSFAESCKPVQQP |
Disease Category: | Cancer |
Disease: | Prostate Cancer |
Disease Subtype: | |
Disease Cellline: | LNCaP |
Disease Info: | |
Drug: | AZD5363 |
Drug Info: | "Capivasertib (AZD5363) is an orally active pan-AKT kinase inhibitor that inhibits Akt1, Akt2, and Akt3 with IC50 values of 3, 7, and 7 nM, respectively." |
Effect: | modulate |
Effect Info: | "AZD5363 can effectively reduce the growth of various tumor models. AZD5363 effectively inhibits the phosphorylation of S6 and 4E - BP1 in these cell lines, and simultaneously increases the phosphorylation of AKT at ser473 and thr308 sites." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 22294718 |
Sentence Index: | 22294718_5-6 |
Sentence: | "Oral dosing of AZD5363 to nude mice caused dose- and time-dependent reduction of PRAS40, GSK3beta, and S6 phosphorylation in BT474c xenografts (PRAS40 phosphorylation EC(50) ~ 0.1 mumol/L total plasma exposure), reversible increases in blood glucose concentrations, and dose-dependent decreases in 2[18F]fluoro-2-deoxy-D-glucose ((18)F-FDG) uptake in U87-MG xenografts. Chronic oral dosing of AZD5363 caused dose-dependent growth inhibition of xenografts derived from various tumor types, including HER2(+) breast cancer models that are resistant to trastuzumab." |
Sequence & Structure:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 4 | - | bipolar I disorder | DailyMed DailyMed DailyMed |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 4 | Completed | bipolar I disorder | ClinicalTrials ClinicalTrials |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 4 | Withdrawn | bipolar I disorder | ClinicalTrials |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 4 | Unknown status | bipolar I disorder | ClinicalTrials ClinicalTrials |
GSK3B | LITHIUM CITRATE | Glycogen synthase kinase-3 inhibitor | 4 | - | bipolar I disorder | DailyMed |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 4 | Completed | depressive disorder | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 4 | Terminated | depressive disorder | ClinicalTrials |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 4 | Unknown status | depressive disorder | ClinicalTrials ClinicalTrials ClinicalTrials |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 4 | - | major depressive disorder | DailyMed |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 4 | Recruiting | depressive disorder | ClinicalTrials |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 4 | Completed | bipolar disorder | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 4 | Unknown status | bipolar disorder | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 4 | - | bipolar disorder | DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed DailyMed |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 4 | Recruiting | bipolar disorder | ClinicalTrials ClinicalTrials |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 4 | Terminated | bipolar disorder | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 4 | Withdrawn | bipolar disorder | ClinicalTrials ClinicalTrials |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 3 | Completed | stroke | ClinicalTrials |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 3 | Recruiting | internal carotid artery stenosis | ClinicalTrials |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 3 | Completed | aggressive behavior | ClinicalTrials |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 3 | Recruiting | carotid artery disease | ClinicalTrials |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 3 | Active, not recruiting | autism spectrum disorder | ClinicalTrials |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 3 | Completed | conduct disorder | ClinicalTrials |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 3 | Terminated | anxiety | ClinicalTrials |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 3 | Completed | treatment resistant depression | ClinicalTrials |
GSK3B | LITHIUM CARBONATE | Glycogen synthase kinase-3 inhibitor | 3 | Completed | bipolar I disorder | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACGSK3B-Ser9 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | -0.707 |
HGSC | 0.707 |
ccRCC | |
GBM | |
HNSC | |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 9 | D | Diabetes mellitus | Phosphorylation | 15033922 |
S | 9 | D | Pancreatic cancer/carcinoma/adenocarcinoma | Phosphorylation | 23408967 |
S | 9 | D | Triple-negative breast cancer | Phosphorylation | 35090098 |
S | 9 | D | Alzheimer's disease | Phosphorylation | 22278060 |
S | 9 | D | Schizophrenia | Phosphorylation | 14745448 |
S | 9 | D | Parkinson's disease | Phosphorylation | 27609071 |
S | 9 | P | Breast cancer | Phosphorylation | 36632451 |
S | 9 | P | Ovarian cancer/carcinoma | Phosphorylation | 23667667 |
S | 9 | P | Lung cancer/carcinoma | Phosphorylation | 23149922 |
S | 9 | P | Liver cancer | Phosphorylation | 23325562 |
S | 9 | P | Gastric cancer | Phosphorylation | 23123500 |
S | 9 | U | Lung adenocarcinoma | Phosphorylation | 33808696 |
S | 9 | U | Hepatocellular carcinoma | Phosphorylation | 34484860 |
S | 9 | U | Breast cancer | Phosphorylation | 17495324 ;  35173161 ;  17495324 |
S | 9 | U | Non-small cell lung cancer | Phosphorylation | 36869126 |
S | 9 | U | Lung cancer/carcinoma | Phosphorylation | 23514933 |
S | 9 | U | Melanoma | Phosphorylation | 35347072 |
S | 9 | U | Systemic scleroderma | Phosphorylation | 35853487 |
S | 9 | U | Systemic lupus erythematosus | Phosphorylation | 23735868 |
S | 9 | U | Squamous cell carcinoma | Phosphorylation | 18606491 |
S | 9 | U | Skin cancer | Phosphorylation | 18606491 |
S | 9 | U | Papillomas | Phosphorylation | 18606491 |
S | 9 | U | Ovarian cancer | Phosphorylation | 15208673 |
S | 9 | U | Neuroblastoma | Phosphorylation | 30154149 |
S | 9 | U | Major depressive disorder | Phosphorylation | 22622071 |
S | 9 | U | Lymphoma | Phosphorylation | 20224723 |
S | 9 | U | Granulomatosis with polyangiitis | Phosphorylation | 37720230 |
S | 9 | U | Dilated cardiomyopathy | Phosphorylation | 37852321 |
S | 9 | U | Diabetes mellitus | Phosphorylation | 35835217 |
S | 9 | U | Cardiomyopathy | Phosphorylation | 37852321 |
S | 9 | U | Breast cancer/tumor/carcinoma | Phosphorylation | 17495324 ;  27494834 |
S | 9 | U | Bipolar disorder | Phosphorylation | 16806104 |
S | 9 | U | Alzheimer's disease | Phosphorylation | 22278060 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMProtein | Gene | PTM | Position | Modified sequence | Cell | Drug | pEC50 | Regulation | Experiment |
---|---|---|---|---|---|---|---|---|---|
P49841 | GSK3B | P | Ser9 | TTS(ph)FAESCKPVQQPSAFGSMK | HeLa | CUDC101 | 1 | up | |
P49841 | GSK3B | P | Ser9 | TTS(ph)FAESCKPVQQPSAFGSMK | A459 | MK2206 | 7.2049 | down | |
P49841 | GSK3B | P | Ser9 | TTS(ph)FAESCKPVQQPSAFGSMK | A459 | SelumetinibMK2206-1to2 | 7.4614 | down | |
P49841 | GSK3B | P | Ser9 | TTS(ph)FAESCKPVQQPSAFGSMK | A459 | SelumetinibMK2206-3to1 | 7.0611 | down | |
P49841 | GSK3B | P | Ser9 | TTS(ph)FAESCKPVQQPSAFGSMK | PC-9 | GeftinibAZD4547-1to80 | 8.6743 | down | |
P49841 | GSK3B | P | Ser9 | TTS(ph)FAESCKPVQQPSAFGSMK | PC-9 | Lapatinib | 6.6407 | down | |
P49841 | GSK3B | P | Ser9 | TTS(ph)FAESCKPVQQPSAFGSMK | A459 | MK2206 | 7.0039 | - | |
P49841 | GSK3B | P | Ser9 | TTS(ph)FAESCKPVQQPSAFGSMK | A459 | Selumetinib | 6.2144 | - | |
P49841 | GSK3B | P | Ser9 | TTS(ph)FAESCKPVQQPSAFGSMK | HeLa | Curcumin | 5.2589 | - | |
P49841 | GSK3B | P | Ser9 | TTS(ph)FAESCKPVQQPSAFGSMK | PC-9 | AZD4547 | 5.5148 | - | |
P49841 | GSK3B | P | Ser9 | TTS(ph)FAESCKPVQQPSAFGSMK | PC-9 | Gefitinib | 8.2709 | - |
pEC50 Note: pEC50 is the negative logarithm of EC50 (half-maximal effective concentration, dosage unit Mol), calculated as pEC50 = -log10(EC50), which quantifies the potency of a drug or compound.
Function score:
source: funscoRNo data.