Id: acc2329
Group: 2sens
Protein: Smad3
Gene Symbol: SMAD3
Protein Id: P84022
Protein Name: SMAD3_HUMAN
PTM: phosphorylation
Site: Ser423
Site Sequence: MGSPSIRCSSVS---------
Disease Category: Cancer
Disease: Breast Cancer
Disease Subtype:
Disease Cellline: MDA-MB-231
Disease Info:
Drug: SSA
Drug Info: -
Effect: modulate
Effect Info: SSA can specifically reduce the motility of breast tumor cells by directly blocking the phosphorylation of Smad2/3 without affecting the growth of tumor cells.
Note:
Score: 4.0
Pubmed(PMID): 26769851
Sentence Index:
Sentence:

Sequence & Structure:

MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets
Small molecule
Antibody
PROTAC
Other modalities
Approved Drug
Advanced Clinical
Phase 1 Clinical
Structure with Ligand
High-Quality Ligand
High-Quality Pocket
Med-Quality Pocket
Druggable Family
Approved Drug
Advanced Clinical
Phase 1 Clinical
UniProt loc high conf
GO CC high conf
UniProt loc med conf
UniProt SigP or TMHMM
GO CC med conf
Human Protein Atlas loc
Approved Drug
Advanced Clinical
Phase 1 Clinical
Literature
UniProt Ubiquitination
Database Ubiquitination
Half-life Data
Small Molecule Binder
Approved Drug
Advanced Clinical
Phase 1 Clinical

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
K 333 D Nonalcoholic steatohepatitis Acetylation 32305562
K 341 D Renal fibrosis Acetylation 37777567
K 378 D Nonalcoholic steatohepatitis Acetylation 32305562
K 378 D Renal fibrosis Acetylation 37777567
K 20 U Triple-negative breast cancer Acetylation 34392614
K 117 U Triple-negative breast cancer Acetylation 34392614
K 333 U Melanoma Acetylation 29520103
K 53 U Cancer Methylation 35085106
K 333 U Cancer Methylation 35085106
T 179 U Breast cancer Phosphorylation 33051597
S 213 U Prostate cancer Phosphorylation 36536346

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: