Id: acc2397
Group: 2sens
Protein: H2AX
Gene Symbol: H2AX
Protein Id: P16104
Protein Name: H2AX_HUMAN
PTM: methylation
Site: Lys134
Site Sequence: VGPKAPSGGKKATQASQEY--
Disease Category: Cancer
Disease: Lung Cancer
Disease Subtype: NSCLC
Disease Cellline: A549
Disease Info:
Drug: doxorubicin
Drug Info: "Doxorubicin is a cytotoxic anthracycline antibiotic and anticancer chemotherapeutic agent that inhibits human DNA topoisomerase I and II with IC50 values of 0.8 μM and 2.67 μM, respectively, and induces apoptosis and autophagy."
Effect: inhibit
Effect Info: "Protein methyltransferase SUV39H2 can methylate lysine 134 of histone H2AX and enhance the formation of phosphorylated H2AX (gamma-H2AX), thereby leading to chemotherapy resistance in cancer cells."
Note: histone
Score: 4.0
Pubmed(PMID): 30159125
Sentence Index:
Sentence:

Sequence & Structure:

MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets
Small molecule
Antibody
PROTAC
Other modalities
Approved Drug
Advanced Clinical
Phase 1 Clinical
Structure with Ligand
High-Quality Ligand
High-Quality Pocket
Med-Quality Pocket
Druggable Family
Approved Drug
Advanced Clinical
Phase 1 Clinical
UniProt loc high conf
GO CC high conf
UniProt loc med conf
UniProt SigP or TMHMM
GO CC med conf
Human Protein Atlas loc
Approved Drug
Advanced Clinical
Phase 1 Clinical
Literature
UniProt Ubiquitination
Database Ubiquitination
Half-life Data
Small Molecule Binder
Approved Drug
Advanced Clinical
Phase 1 Clinical

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
K 134 U Bladder cancer Methylation 25487737
K 134 U Lung cancer Methylation 25487737

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: