Id: | acc2400 |
Group: | 2sens |
Protein: | H2AX |
Gene Symbol: | H2AX |
Protein Id: | P16104 |
Protein Name: | H2AX_HUMAN |
PTM: | phosphorylation |
Site: | Ser139 |
Site Sequence: | PSGGKKATQASQEY------- |
Disease Category: | Cancer |
Disease: | Breast Cancer |
Disease Subtype: | |
Disease Cellline: | MDA-MB-231 |
Disease Info: | |
Drug: | OTS193320 |
Drug Info: | "OTS193320 is a potent inhibitor of the protein methyltransferase SUV39H2 with an IC50 of 22.2 nM, significantly reducing global H3K9 trimethylation (H3K9me3) and inducing apoptotic cell death in breast cancer cells, while also inhibiting growth in SUV39H2-positive A549 lung cancer cells with an IC50 of 0.38 μM." |
Effect: | modulate |
Effect Info: | "Protein methyltransferase SUV39H2 can methylate lysine 134 of histone H2AX and enhance the formation of phosphorylated H2AX (gamma - H2AX), leading to chemotherapy resistance in cancer cells." |
Note: | histone |
Score: | 3.0 |
Pubmed(PMID): | 30159125 |
Sentence Index: | 30159125_0-1 |
Sentence: | "Development of novel SUV39H2 inhibitors that exhibit growth suppressive effects in mouse xenograft models and regulate the phosphorylation of H2AX. Protein methyltransferase SUV39H2 was reported to methylate histone H2AX at lysine 134 and enhance the formation of phosphorylated H2AX (gamma-H2AX), which causes chemoresistance of cancer cells." |
Sequence & Structure:
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 139 | U | Acute myelogenous leukemia | Phosphorylation | 33691101 |
S | 139 | U | Hepatocellular carcinoma | Phosphorylation | 25537504 |
S | 139 | U | Multiple myeloma | Phosphorylation | 35190641 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.