| Id: | acc2407 |
| Group: | 2sens |
| Protein: | BCL2 |
| Gene Symbol: | Bcl2 |
| Protein Id: | P10417 |
| Protein Name: | BCL2_MOUSE |
| PTM: | phosphorylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Cancer |
| Disease: | Lung Cancer |
| Disease Subtype: | |
| Disease Cellline: | LKR |
| Disease Info: | |
| Drug: | Cisplatin |
| Drug Info: | "Cisplatin is a platinum-based chemotherapeutic agent widely used in the treatment of various malignancies, including ovarian, bladder, testicular, and non-small cell lung cancers, by forming DNA cross-links to interfere with replication and repair, thereby inhibiting cancer cell growth and proliferation." |
| Effect: | increase |
| Effect Info: | "Nicotine reduces the ubiquitination and degradation of Bcl - 2, thereby reducing the sensitivity of lung cancer cells to cisplatin." |
| Note: | |
| Score: | 5.0 |
| Pubmed(PMID): | 24548862 |
| Sentence Index: | 24548862_5-6 |
| Sentence: | "RESULTS: We demonstrated that the addition of nicotine greatly attenuated Bcl-2 ubiquitination and degradation, which further desensitised lung cancer cells to cisplatin-induced cytotoxicity. In this process, Bcl-2 was persistently phosphorylated in the cells cotreated with nicotine and cisplatin." |
Sequence & Structure:
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
