Id: acc2433
Group: 2sens
Protein: H2AX
Gene Symbol: H2AX
Protein Id: P16104
Protein Name: H2AX_HUMAN
PTM: phosphorylation
Site: Ser139
Site Sequence: PSGGKKATQASQEY-------
Disease Category: Cancer
Disease: Melanoma
Disease Subtype:
Disease Cellline: RPMI7951
Disease Info:
Drug: arsenite
Drug Info: -
Effect: modulate
Effect Info: As3+ induces the phosphorylation of TOPK and histone H2AX in RPMI7951 human melanoma cells and induces apoptosis of human melanoma cells.
Note: histone
Score: 3.0
Pubmed(PMID): 17145805
Sentence Index:
Sentence:

Sequence & Structure:

MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets
Small molecule
Antibody
PROTAC
Other modalities
Approved Drug
Advanced Clinical
Phase 1 Clinical
Structure with Ligand
High-Quality Ligand
High-Quality Pocket
Med-Quality Pocket
Druggable Family
Approved Drug
Advanced Clinical
Phase 1 Clinical
UniProt loc high conf
GO CC high conf
UniProt loc med conf
UniProt SigP or TMHMM
GO CC med conf
Human Protein Atlas loc
Approved Drug
Advanced Clinical
Phase 1 Clinical
Literature
UniProt Ubiquitination
Database Ubiquitination
Half-life Data
Small Molecule Binder
Approved Drug
Advanced Clinical
Phase 1 Clinical

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
S 139 U Acute myelogenous leukemia Phosphorylation 33691101
S 139 U Hepatocellular carcinoma Phosphorylation 25537504
S 139 U Multiple myeloma Phosphorylation 35190641

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: