| Id: | acc2510 |
| Group: | 2sens |
| Protein: | SOX10 |
| Gene Symbol: | SOX10 |
| Protein Id: | P56693 |
| Protein Name: | SOX10_HUMAN |
| PTM: | sumoylation |
| Site: | Lys55 |
| Site Sequence: | PGPGELGKVKKEQQDGEADDD |
| Disease Category: | Cancer |
| Disease: | Melanoma |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | vemurafenib |
| Drug Info: | "Vemurafenib is a BRAF kinase inhibitor used for the treatment of patients with unresectable or metastatic melanoma harboring BRAF V600 mutation, administered orally as a targeted therapy." |
| Effect: | inhibit |
| Effect Info: | "SAMMSON overexpression confers resistance to vemurafenib-induced cytotoxicity in melanoma cells. SOX10 mediates the transcriptional induction of SAMMSON by vemurafenib, and SOX10 sumoylation at the K55 site is crucial for this function." |
| Note: | |
| Score: | 5.0 |
| Pubmed(PMID): | 34087780 |
| Sentence Index: | 34087780_3-4 |
| Sentence: | "In this work, we showed that SAMMSON is rapidly induced upon inhibition of ERK signaling, and SAMMSON overexpression conferred resistance to vemurafenib-induced cytotoxicity in melanoma cells. SOX10 mediated transcriptional induction of SAMMSON by vemurafenib, and SOX10 sumoylation at K55 was essential for this function." |
Sequence & Structure:
MAEEQDLSEVELSPVGSEEPRCLSPGSAPSLGPDGGGGGSGLRASPGPGELGKVKKEQQDGEADDDKFPVCIREAVSQVLSGYDWTLVPMPVRVNGASKSKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPTPPTTPKTELQSGKADPKRDGRSMGEGGKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP
No data.
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
