Id: | acc2554 |
Group: | 2sens |
Protein: | Trx1 |
Gene Symbol: | TXN |
Protein Id: | P10599 |
Protein Name: | THIO_HUMAN |
PTM: | oxidation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Cancer |
Disease: | Breast Cancer |
Disease Subtype: | |
Disease Cellline: | MDA-MB-231 |
Disease Info: | |
Drug: | 2DG + DHEA |
Drug Info: | "2DG (2-Deoxy-D-glucose) is a glucose analog that inhibits glycolysis by competitively blocking glucose metabolism, often used in cancer research to study metabolic pathways and potential therapeutic targets. DHEA (Dehydroepiandrosterone) is a steroid hormone precursor with roles in immune modulation, metabolism, and anti-aging research, often studied for its potential effects on energy balance and cellular function" |
Effect: | enhance |
Effect Info: | Protein oxidation promotes the killing effect of drugs on cancer. |
Note: | |
Score: | 5.0 |
Pubmed(PMID): | 25560241 |
Sentence Index: | 25560241_5-6 |
Sentence: | "Redox Western blot analysis of PC-3 cells also supported the conclusion that thioredoxin-1 (Trx-1) oxidation was enhanced by treatment DHEA+Au and inhibited by NAC. Importantly, normal human mammary epithelial cells (HMEC) were not as sensitive to 2DG, DHEA, and Au combinations as their cancer cell counterparts (MDA-MB-231)." |
Sequence & Structure:
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
TXN | PX-12 | Thioredoxin inhibitor | 2 | Terminated | pancreatic neoplasm | ClinicalTrials |
TXN | PX-12 | Thioredoxin inhibitor | 1 | Completed | cancer | ClinicalTrials |
TXN | PX-12 | Thioredoxin inhibitor | 1 | Completed | metastatic malignant neoplasm | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.