PMADS

Id:	acc2559
Group:	2sens
Protein:	Trx1
Gene Symbol:	TXN
Protein Id:	P10599
Protein Name:	THIO_HUMAN
PTM:	oxidation
Site:	Cys62
Site Sequence:	IFLEVDVDDCQDVASECEVKC
Disease Category:	Cancer
Disease:	Neuroblastoma
Disease Subtype:
Disease Cellline:	SH-SH5Y
Disease Info:
Drug:	As(2-mercaptopyridine)3
Drug Info:	-
Effect:	enhance
Effect Info:	Drugs oxidize proteins and promote the death of cancer cells.
Note:
Score:	5.0
Pubmed(PMID):	26169724
Sentence Index:	26169724_8-9
Sentence:	"Oxidation of Trx1 by As(2-mercaptopyridine)3 and As(2-mercaptopyridine N-oxide)3 affected electron transfer from NADPH and TrxR1 to peroxiredoxin 1 (Prx1), which could result in the reactive oxygen species elevation and trigger cell death process. These results suggest that oxidation of structural cysteine residues in Trx1 by aromatic group in TrxR1-targeting drugs may sensitize tumor cells to cell death, providing a novel approach to regulate cellular redox signaling and also a basis for rational design of new anticancer agents."

Sequence & Structure:

MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

Target	Drug name	MOA	Phase	Status	Disease	Source
TXN	PX-12	Thioredoxin inhibitor	2	Terminated	pancreatic neoplasm	ClinicalTrials
TXN	PX-12	Thioredoxin inhibitor	1	Completed	cancer	ClinicalTrials
TXN	PX-12	Thioredoxin inhibitor	1	Completed	metastatic malignant neoplasm	ClinicalTrials

Note: Only show clinically investigational or approved drugs with protein targets.

Protein Tractability:

source: Open Targets

Small molecule

Antibody

PROTAC

Other modalities

Approved Drug

Advanced Clinical

Phase 1 Clinical

Structure with Ligand

High-Quality Ligand

High-Quality Pocket

Med-Quality Pocket

Druggable Family

Approved Drug

Advanced Clinical

Phase 1 Clinical

UniProt loc high conf

GO CC high conf

UniProt loc med conf

UniProt SigP or TMHMM

GO CC med conf

Human Protein Atlas loc

Approved Drug

Advanced Clinical

Phase 1 Clinical

Literature

UniProt Ubiquitination

Database Ubiquitination

Half-life Data

Small Molecule Binder

Approved Drug

Advanced Clinical

Phase 1 Clinical

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links:

CTD
DMRdb