Id: | acc2561 |
Group: | 2sens |
Protein: | Trx1 |
Gene Symbol: | TXN |
Protein Id: | P10599 |
Protein Name: | THIO_HUMAN |
PTM: | oxidation |
Site: | Cys62 |
Site Sequence: | IFLEVDVDDCQDVASECEVKC |
Disease Category: | Cancer |
Disease: | Neuroblastoma |
Disease Subtype: | |
Disease Cellline: | SH-SH5Y |
Disease Info: | |
Drug: | As(2-mercaptopyridine N-oxide)3 |
Drug Info: | "2-Mercaptopyridine N-oxide is a chemical compound with bactericidal activity, particularly against Mycobacterium tuberculosis, and is used in research for its potential therapeutic applications." |
Effect: | enhance |
Effect Info: | Drugs oxidize proteins and promote the death of cancer cells. |
Note: | |
Score: | 5.0 |
Pubmed(PMID): | 26169724 |
Sentence Index: | 26169724_8-9 |
Sentence: | "Oxidation of Trx1 by As(2-mercaptopyridine)3 and As(2-mercaptopyridine N-oxide)3 affected electron transfer from NADPH and TrxR1 to peroxiredoxin 1 (Prx1), which could result in the reactive oxygen species elevation and trigger cell death process. These results suggest that oxidation of structural cysteine residues in Trx1 by aromatic group in TrxR1-targeting drugs may sensitize tumor cells to cell death, providing a novel approach to regulate cellular redox signaling and also a basis for rational design of new anticancer agents." |
Sequence & Structure:
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
TXN | PX-12 | Thioredoxin inhibitor | 2 | Terminated | pancreatic neoplasm | ClinicalTrials |
TXN | PX-12 | Thioredoxin inhibitor | 1 | Completed | cancer | ClinicalTrials |
TXN | PX-12 | Thioredoxin inhibitor | 1 | Completed | metastatic malignant neoplasm | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.