Id: | acc2566 |
Group: | 1sens |
Protein: | Smad3 |
Gene Symbol: | SMAD3 |
Protein Id: | P84022 |
Protein Name: | SMAD3_HUMAN |
PTM: | phosphorylation |
Site: | Thr179 |
Site Sequence: | IEPQSNIPETPPPGYLSEDGE |
Disease Category: | Cancer |
Disease: | Hepatocellular Carcinoma |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | |
Drug Info: | #N/A |
Effect: | suppress |
Effect Info: | The heme oxygenase-1/carbon monoxide axis inhibits transforming growth factor-beta1-induced growth arrest in human hepatocellular carcinoma cell lines by increasing ERK1/2-mediated phosphorylation of Smad3 at Thr-179. |
Note: | Non-conventional drugs |
Score: | 4.5 |
Pubmed(PMID): | 29524413 |
Sentence Index: | 29524413_0 |
Sentence: | Heme oxygenase-1/carbon monoxide axis suppresses transforming growth factor-beta1-induced growth inhibition by increasing ERK1/2-mediated phosphorylation of Smad3 at Thr-179 in human hepatocellular carcinoma cell lines. |
Sequence & Structure:
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
T | 179 | U | Breast cancer | Phosphorylation | 33051597 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.