Id: | acc2594 |
Group: | 2sens |
Protein: | PP2A |
Gene Symbol: | PTPA |
Protein Id: | Q15257 |
Protein Name: | PTPA_HUMAN |
PTM: | methylation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Cancer |
Disease: | Glioblastoma |
Disease Subtype: | |
Disease Cellline: | U251MG |
Disease Info: | |
Drug: | radiotherapy |
Drug Info: | - |
Effect: | increase |
Effect Info: | "When the generation of reactive oxygen species (ROS) is triggered by radiotherapy or chemotherapy, it stimulates the activity of PME - 1, leading to more demethylation of PP2A, thereby enhancing the survival and proliferation abilities of tumor cells." |
Note: | Non-conventional drugs |
Score: | 4.5 |
Pubmed(PMID): | 37500619 |
Sentence Index: | 37500619_4-5 |
Sentence: | "Protein phosphatase methylesterase-1 (PME-1), a regulator of the tumor suppressive phosphatase PP2A, promotes PP2A demethylation and inactivation, and is overexpressed in 44% of GBM, associated with increased tumor grade and cellular proliferation. Here, we aimed to investigate how reactive oxygen species (ROS), a frequent by-product of radiotherapy and temozolomide chemotherapy, regulate PP2A function via its methylesterase PME-1, and how PME-1 overexpression impacts the response of GBM cells to oxidative stress." |
Sequence & Structure:
MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEMWNEVHEEKEQAAKQSVSCDECIPLPRAGHCAPSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.