| Id: | acc2595 |
| Group: | 2sens |
| Protein: | PP2A |
| Gene Symbol: | PTPA |
| Protein Id: | Q15257 |
| Protein Name: | PTPA_HUMAN |
| PTM: | methylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Cancer |
| Disease: | Glioblastoma |
| Disease Subtype: | |
| Disease Cellline: | U251MG |
| Disease Info: | |
| Drug: | temozolomide(TMZ) |
| Drug Info: | "Temozolomide (TMZ) is an alkylating chemotherapeutic agent primarily used in the treatment of glioblastoma multiforme, functioning by inhibiting DNA synthesis in cancer cells through methylation of guanine residues, and is often administered in combination with radiotherapy." |
| Effect: | increase |
| Effect Info: | "When reactive oxygen species (ROS) production is induced by radiotherapy or chemotherapy, it stimulates the activity of PME - 1, leading to more demethylation of PP2A, thereby enhancing the survival and proliferation abilities of tumor cells." |
| Note: | |
| Score: | 5.0 |
| Pubmed(PMID): | 37500619 |
| Sentence Index: | 37500619_4-5 |
| Sentence: | "Protein phosphatase methylesterase-1 (PME-1), a regulator of the tumor suppressive phosphatase PP2A, promotes PP2A demethylation and inactivation, and is overexpressed in 44% of GBM, associated with increased tumor grade and cellular proliferation. Here, we aimed to investigate how reactive oxygen species (ROS), a frequent by-product of radiotherapy and temozolomide chemotherapy, regulate PP2A function via its methylesterase PME-1, and how PME-1 overexpression impacts the response of GBM cells to oxidative stress." |
Sequence & Structure:
MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEMWNEVHEEKEQAAKQSVSCDECIPLPRAGHCAPSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
