Id: acc2597
Group: 2sens
Protein: AROS
Gene Symbol: RPS19BP1
Protein Id: Q86WX3
Protein Name: AROS_HUMAN
PTM: methylation
Site: Lys27
Site Sequence: APRDPPGQAKPRGAPVKRPRK
Disease Category: Cancer
Disease: Colorectal Cancer
Disease Subtype:
Disease Cellline: HCT116
Disease Info:
Drug: radiotherapy
Drug Info: -
Effect: inhibit
Effect Info: "LEM-14 inhibits NSD2, weakens the methylation level of AROS, reduces FAO, and thus promotes chemotherapy."
Note: Non-conventional drugs
Score: 4.5
Pubmed(PMID): 37756162
Sentence Index:
Sentence:

Sequence & Structure:

MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets
Small molecule
Antibody
PROTAC
Other modalities
Approved Drug
Advanced Clinical
Phase 1 Clinical
Structure with Ligand
High-Quality Ligand
High-Quality Pocket
Med-Quality Pocket
Druggable Family
Approved Drug
Advanced Clinical
Phase 1 Clinical
UniProt loc high conf
GO CC high conf
UniProt loc med conf
UniProt SigP or TMHMM
GO CC med conf
Human Protein Atlas loc
Approved Drug
Advanced Clinical
Phase 1 Clinical
Literature
UniProt Ubiquitination
Database Ubiquitination
Half-life Data
Small Molecule Binder
Approved Drug
Advanced Clinical
Phase 1 Clinical

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: