Id: | acc2597 |
Group: | 2sens |
Protein: | AROS |
Gene Symbol: | RPS19BP1 |
Protein Id: | Q86WX3 |
Protein Name: | AROS_HUMAN |
PTM: | methylation |
Site: | Lys27 |
Site Sequence: | APRDPPGQAKPRGAPVKRPRK |
Disease Category: | Cancer |
Disease: | Colorectal Cancer |
Disease Subtype: | |
Disease Cellline: | HCT116 |
Disease Info: | |
Drug: | radiotherapy |
Drug Info: | - |
Effect: | inhibit |
Effect Info: | "LEM-14 inhibits NSD2, weakens the methylation level of AROS, reduces FAO, and thus promotes chemotherapy." |
Note: | Non-conventional drugs |
Score: | 4.5 |
Pubmed(PMID): | 37756162 |
Sentence Index: | 37756162_3-4 |
Sentence: | "NSD2, a histone methyltransferase that catalyzes di-methylation of histone H3 at lysine 36, has been shown to play an essential role in tumorigenesis and cancer progression. Here, we show that NSD2 promotes fatty acid oxidation (FAO) by methylating AROS (active regulator of SIRT1) at lysine 27, facilitating the physical interaction between AROS and SIRT1." |
Sequence & Structure:
MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.